21. September 2019
    
Základy evolučnej teórie - Dolezite.sk

Základy evolučnej teórie


  2011-09-28  (17:12)  |  Náboženstvo a mystika
  50% hlasovalo = 0  
mínus plus


Přírodní konopné mýdlo
Přírodní ...
portréty
portréty
Zamilovaný vešiak
Zamilovaný ...
Citrón a zázvor
Citrón a z...
 - Základy evolučnej teórie


Existencia rastlinných a živočíšnych druhov „tak dokonale prispôsobených svojmu prostrediu“ fascinovala ľudí oddávna. Nie div, že si ju vysvetľovali tým najjednoduchším spôsobom, aký si vedeli predstaviť: tak ako si ľudia dokážu ušiť odev na svoju mieru, ktosi oveľa mocnejší vraj „zhotovil“ rôzne živočíšne druhy na mieru prostredia. Bola to predstava verbálne veľmi jednoduchá, ibaže jej chýbali akékoľvek detaily: nevysvetľovala technológiu, akou boh jednotlivé druhy tvoril, nehovorila nič o materiáli, ktorý pri svojej práci použil – jednoducho „stvoril z ničoho“. Hlavne však chýbal dôkaz, že akási taká mocná bytosť skutočne jestvuje, a že ona všetko živé naozaj aj stvorila.

Opakujem pre istotu ešte raz, že hlavným nedostatkom tejto tzv. kreačnej „teórie“ je to, že s povrchnosťou do neba volajúcou, povyšuje – bez akéhokoľvek dôkazu – fiktívnu „možnosť“ na skutočnosť.

„Boh učinil rozličné druhy poľnej zveri, rozličné druhy dobytka a všetky zemeplazy rozličných druhov.“
(Gn 1, 25)

Obsah evolučnej teórie
Logika kreacionizmu
Premena výsledku na cieľ: zrod teleológie
Štandardné dôkazy evolúcie
Spoločnými chybami proti kreacionizmu!
Digitálna interpretácia evolúcie
Najbežnejšie fundamentalistické námietky voči evolúcii



S postupným rozvojom aplikovaných vied sa však okrem nedokázateľnosti začali objavovať aj fakty, ktoré priamo odporovali implikáciám tejto jednoduchej „teórie“. Geológovia začali v hlbokých – a teda starých – vrstvách usadenín nachádzať fosílie živočíchov, aké dnes nejestvujú. To sa ešte dalo ako tak vysvetliť vyhynutím ťažkopádnych monštier. Čo sa už tak jednoducho vysvetliť nedalo, bolo to, že v starých vrstvách sa len mimoriadne zriedkavo nachádzali pozostatky živočíšnych druhov podobných súčasným, a to bolo veľmi podivné. Žiaden živočích totiž nemôže zariadiť, aby po smrti po ňom nezostala ani stopa. A živočíchy, ktoré dnes nachádzame v skamenenej podobe sa od súčasných živočíchov nelíšili ničím, čo by mohlo spôsobiť, že by jedny skameneli a druhé nie. Paleontologické múzeá sveta vystavujú ešte aj exempláre pavúkov mumifikovaných v jantári, jestvuje dosť skamenelín živočíchov zrovnateľných veľkosťou aj tkanivovým zložením s človekom, len v dobách dinosaurov sa zrejme každý človek a každý „moderný“ živočích veľmi úspešne vyhol konečnému osudu fosílie. Dalo by sa, samozrejme, tvrdiť, že sa o takú selekciu postaral dobrotivý stvoriteľ, aby vodil paleontológov za nos, len akosi sa nikto s takým vysvetlením neponáhľal. Mýtus o stvorení zvierat za jeden deň začal mať trhliny. Udatne sa do ich zaplátania pustil Georges Cuvier (1769-1832), ktorý si doslova vymyslel, že Zem postihla celá séria pohrôm, z ktorých poslednou bola akurát Noemova potopa; tieto katastrofy vyhubili všetky exempláre prastarých živočíšnych druhov a na ich miesto privandrovali z iných končín Zeme druhy „iné“, či dokonca dobrotivý pánboh nové druhy po každej pohrome stvoril. Samozrejme, že aj toto celkom „prirodzené“ vysvetlenie obišlo podozrivým mlčaním taký jednoduchý fakt, že katastrofy vždy ušetrili druhy dnes bežné, hlavne človeka.

Dnes už mýtu o stvorení živočíchov za jediný deň nenúti veriť ani katolícka cirkev, i keď by ste márne čakali, že sa táto zvesť ozve z niektorej kazateľnice. Tento fakt je pred zrakmi radových ovečiek starostlivo schovaný ešte aj v KKC, kde tiež nie je formulovaný zvlášť explicitne (zrejme to cirkev nepovažuje za dôležité). Mne sa podarilo nájsť len takéto veľmi nepriame výroky: „Otázka o pôvode sveta a človeka je predmetom mnohých vedeckých výskumov, ktoré veľmi obohatili naše poznatky o veku a rozmeroch vesmíru, o vznikaní živých foriem, o prvom objavení sa človeka“ (KKC § 283). „Nejde len o to, aby sa vedelo, kedy a ako skutočne vznikol vesmír, ani kedy sa objavil človek, ale skôr o to, aby sa zistilo, aký je zmysel tohto vzniku: či ho riadi náhoda, slepý osud, anonymná nevyhnutnosť, alebo transcendentná, rozumová a dobrá Bytosť, ktorá sa volá Boh“ (KKC § 284). Chápem veľmi dobre dôvody tohoto zahmleného vyjadrovania: cirkev sa hanbí priznať, že Biblia obsahuje babylonské mýty o stvorení sveta. Ale z posledného citátu sa dá tiež akosi implicitne vytušiť, že ak cirkev evolúciu aj (hrozne neochotne) pripúšťa, potom len za predpokladu, že ju riadi „rozumová a dobrá Bytosť, ktorá sa volá Boh“ a nie akási sprostá náhoda! Lenže táto tupá, slepá, anonymná náhoda je prvým predpokladom jedinej teórie, ktorá bez akýchkoľvek metafyzických a scholastických vytáčok vysvetľuje bezo zvyšku vznik a diverzifikáciu druhov tak ako ich dnes vidíme. Formuloval ju prvý raz Charles R. Darwin (1809-1882) v diele O pôvode druhov prírodným výberom (český preklad NČSAV, Praha 1953). V citátoch budem toto dielo označovať skrátene ako Pôvod.

Samotného Darwina na princípy jeho teórie priviedlo uvažovanie o šľachtiteľských úspechoch pestovateľov rastlín a chovateľov domácich zvierat. Nebudem sa tu zaoberať záhradkárstvom, aj keď poskytuje jeden veľmi silný dôkaz v prospech evolúcie: mnohé sorty ušľachtilého ovocia sa množia iba odrezkami (očkovaním a štepením), takže bez zásahu človeka by sa ich ušľachtilosť stratila, lebo by sa samé nemohli ani len množiť. Neverím, že by niekto chcel vážne tvrdiť, že štepiť stromčeky naučil človeka Jahwe ešte v Edene, a že štepy všetkých stromčekov z rajskej záhrady si židovskí nomádi opatrovali s pietou a hojným zalievaním aj počas slávneho štyridsaťročného putovania Sinajskou púšťou, kam boli vyvedení z Egyptskej krajiny. Preto sa budem venovať radšej plemenám domácich zvierat.

Dúfam, že každý uzná, že medzi plemenami jedného druhu sú nápadné anatomické rozdiely. Porovnajte len pudlíka s chrtom na jednej strane a vlka s kojotom na strane druhej.

„Jednou z prvých vecí, ktorá nás zarazí pri pohľade na jednotlivcov tej istej odrody alebo pododrody našich oddávna pestovaných rastlín alebo zvierat, je práve to, že sa obvykle líšia od seba navzájom viac než ktorékoľvek druhy alebo odrody vo voľnej prírode.“ (Pôvod, s. 12)

Myslíte si, že boh stvoril všetky plemená psov hneď pri stvorení sveta? Myslieť si to môžete, ale zoológovia majú aj historické dôkazy o tom, že čím ďalej do minulosti ideme, tým je plemien psov menej. Nenašli sa žiadne nálezy kostier ratlíkov ani buldogov, iba kostry psov podobných vlkom. Dnešné plemená psov boli vyšľachtené za pár tisícročí. Ako je to možné? Darwinovu odpoveď vám silne zjednoduším, pretože toto nie je učebnica biológie, ale polemická stránka o vzťahu vedy a viery.

Rôznorodosť rastlinných a živočíšnych druhov privádza ľudí do extázy práve tým, že sú vynikajúco prispôsobené svojmu prostrediu (do ktorého treba zarátať, pochopiteľne, aj iné rastliny a zvieratá). Darwin si však na šľachtených rastlinách a domácich plemenách zvierat všimol, že sú prispôsobené akurát človeku, jeho vkusu, záujmom, či potrebám. Iste ani vy nechcete tvrdiť, že vôbec jestvuje také prostredie, ktorému by bol dýchavičný psík veľkosti rukavice vynikajúco prispôsobený. Netreba naozaj veľa fantázie, aby sme si všimli, že všetky tzv. okrasné psíky sú prispôsobené len (zvrátenému) ľudskému vkusu. A to podľa Darwina znamená len to, že si ich pre svoj vkus prispôsobil človek sám. O tomto prispôsobovaní jestvujú genealogické doklady a zvyšok doplní tradícia. Jednoducho, nikto nepochybuje, že človek už veľmi dávno vypozoroval v plemenách zvierat, ktoré choval, rôzne odchýlky, a tie exempláre, ktoré sa mu z akéhokoľvek dôvodu páčili, si ponechával a ostatných sa zbavoval.

Možnosť dosiahnuť takúto zmenu u psov, holubov, či koní sa podľa Darwina opiera o tri faktory. Prvý z nich je celkom triviálny: potomci dedia vlastnosti svojich rodičov. Medzi potomkami sa však často vyskytujú odchýlky od vlastností rodičov, ktoré sa ďalej dedia. Príčinu tejto variability potomstva Darwin nepoznal, prijímal ju len ako potvrdený fakt. Tretím faktorom v domácom chove je zámerná selekcia: už spomínané ponechanie zaujímavej odchýlky v ďalšom chove. A Darwin si položil zásadnú otázku: nemožno rovnako vysvetliť aj rozmanitosť všetkých rastlinných a živočíšnych druhov? Nemožno oko a ruku šľachtiteľa nahradiť nejakým faktorom prírody?

Tejto otázke hádam najlepšie rozumie každý, kto sa aspoň trochu zaoberal programovaním. Urobíte si program, ktorý vám napríklad zistí, či zadané číslo je prvočíslom. Taký program je len postupnosť úkonov, ktoré na váš príkaz s otrockou poslušnosťou vykonáva počítač a nazýva sa algoritmus. Algoritmus, ktorý zistí, či zadané číslo je prvočíslo, však nie je jednoduchý a dlho ste sa s ním natrápili. Odskúšali ste ho na mnohých známych prvočíslach i na číslach o ktorých ste vedeli, že prvočíslami nie sú. Po počiatočnej eufórii vás však začne obťažovať potreba zadávať čísla z klávesnice, a zistenia programu o tom, či zadané číslo je prvočíslo, si zapisovať. Ale načo to robiť? Veď nie je nič ľahšie, než urobiť jednoduchý cyklus, ktorý vykoná váš nový program pre zadaný interval čísel a na monitor vám vypíše len nájdené prvočísla a oznámi vám aj ich počet. Z pôvodného algoritmu ste vytvorili algoritmus o pár inštrukcií dlhší, ale môžete ho nechať kontrolovať miliardu čísiel a vy si medzitým môžete odskočiť na pivo.

V jazyku programátorov by sme preto mohli Darwinovu otázku formulovať takto: nejestvuje v prírode algoritmus, ktorý selekciu odchýlok vykonáva bez akéhokoľvek cieľa a zámeru? Nejestvuje algoritmus, ktorý takto vyberá jednotlivcov prispôsobených svojmu prostrediu? Nie je navyše taký algoritmus celkom prírodný v tom zmysle, že ho nikto nenavrhol ani nevymyslel? Nie je teda jednoduchý, neinteligentný a nikým nevymyslený algoritmus práve tým „stvoriteľom“ celej pestrej rozmanitosti živej prírody? Darwinova odpoveď bola kladná a hľadaný algoritmus dostal meno prírodný výber. V nasledujúcom sa pokúsim ukázať, že Darwinov nápad bol až taký geniálny, že algoritmus, ktorý objavil, je univerzálny a jediný: ak kdekoľvek vo Vesmíre má nastať vývoj od jednoduchého k zložitému, Darwinova prírodná selekcia je hádam jediný spôsob, ako k takému cieľu dospieť. Preto si táto geniálna myšlienka právom zasluhuje úctu a uznanie ako navždy najvýznamnejší nápad ľudského ducha, napriek tomu, že je to nápad veľmi jednoduchý. Ale zložitý nemôže byť, pretože je iba popisom bezcieľnych prírodných procesov, ktoré vždy bývajú jednoduché i keď to už rozhodne neplatí o ich produktoch. Práve preto sa treba s pokorou skloniť pred tým jednoduchým a slepým procesom, ktorý stvoril všetko živé, vrátane vedomia a ľudskej inteligencie. Ak si už niečo máme vážiť (netvrdím, že máme), tak je to ten pozoruhodne jednoduchý algoritmus, vďaka ktorému sme tu, vďaka ktorému sme získali inteligenciu, ktorá nám umožnila spoznať rukopis nášho skutočného tvorcu: algoritmu bezcieľnej evolúcie, ktorého naši predkovia mylne považovali za osobného boha. Pri tejto úctivej poklone treba len veriť, že ten istý proces prírodnej selekcie bude pokračovať aj naďalej a že vďaka nemu sa na tvári Zeme raz objaví opäť čosi nové pod Slnkom: lepší a ušľachtilejší tvor, než je dnešný človek.



Obsah evolučnej teórie

Evolúciu by sme mohli stručne definovať ako proces, ktorý v priebehu mnohých generácií vedie k postupným dedičným zmenám populácií. Darwin formuloval svoju hypotézu, ktorá proces evolúcie vysvetľovala, v čase keď sa o podstate dedičnosti ešte nič nevedelo. Neznalosť genetiky mu spôsobovala značné problémy, ktoré si sám uvedomoval a možno aj preto prijímal z učenia J. B. Lamarcka (1744-1829) náznaky predstavy o dedení získaných vlastností. Ešte za jeho života síce brnenský opát Gregor Mendel (1822-1884) odhalil základné zákony genetiky, ale tieto objavy zapadli na desaťročia prachom zabudnutia. Je jasné, že znovuobjavenie genetiky muselo nutne korigovať určité aspekty Darwinovej teórie. Doplnenie Darwinových predstáv o poznatky modernej genetiky a odstránenie posledných stôp lamarckizmu (tzv. „nová syntéza“) sú jediné dve korekcie, ktoré z nej robia to, čo sa niekedy volá (podľa môjho názoru zbytočne) neodarvinizmom. Pokúsim sa teraz stručne popísať evolučnú teóriu v súčasnom chápaní, tak ako ju podáva napríklad známy popularizátor darvinizmu Richard Dawkins. Ak to nebudem zvlášť zdôrazňovať, pojmom druh budem myslieť živočíšny, nie rastlinný druh, pretože my ľudia sme zvieratá, nie rastliny, a o darvinizmus sa zaujímame hlavne preto, že hovorí aj o našom pôvode.

Na úvod však pripomeniem niektoré pojmy genetiky, ktoré nemusia byť každému známe. Všetky informácie o telesnej stavbe jednotlivca sú obsiahnuté v molekulách DNA, z ktorých každá je tvorená dvojicou lineárnych sekvencií nukleotidov. Každý nukleotid je tvorený dusíkatou bázou, pentózou (deoxiribózou) a kyselinou fosforečnou. Nukleotidy sa navzájom líšia iba bázami a molekuly DNA všetkých živých organizmov majú len štyri rôzne bázy (adenin, guanin, tymin, alebo cytozin). Elementárnymi jednotkami genetickej informácie sú trojice (triplety) nukleotidov, ktoré určujú (kódujú) poradie aminokyselín v bielkovinách, ktoré ich pôsobením vznikajú pri delení kdekoľvek v tele, a takisto pri embryogenéze. Triplety predstavujú „abecedu“, pomocou ktorej je zapísaná genetická informácia o celom organizme, a preto sa nazývajú aj kodóny. Veľmi dlhé molekuly DNA obsahujú všetky bunky každého organizmu, a samozrejme aj pohlavné bunky, pomocou ktorých sa informácie o stavbe tela jednotlivca odovzdávajú jeho potomstvu. Tvorba pohlavných buniek sa nazýva gametogenéza a len počas nej sa molekuly DNA v pohlavných bunkách môžu náhodne zmeniť. Tie úseky, alebo kombinácie úsekov DNA, ktoré nesú jednoznačnú informáciu o vlastnostiach jednotlivca, sa nazývajú gény. Súbor všetkých génov, ktoré jednotlivca definujú, sa nazýva genómom.

Nezaškodí tiež spomenúť, že molekuly DNA sú v bunkách uložené v chromozómoch, ktorých počet je u rôznych druhov rôzny. Niektoré obrúčkavce (červy) majú len 12 chromozómov, človek ich má 46, zlatá rybka 104. Keďže zmeny DNA môžu viesť nielen k zmenám v jednotlivých génoch, ale aj k rekombináciam chromozómov a k zmene ich počtu, bolo by nepresné hovoriť len o zmenách génov. Preto dávam prednosť výrazu „zmena genómu“, čím myslím zmenu v celom súhrne informácií všetkých DNA obsiahnutých vo všetkých chromozómoch. Zdôrazňujem to preto, lebo niekedy sa vyskytuje názor, že všetky živočíchy majú rovnaký počet génov, ibaže u niektorých druhov sú niektoré gény „umlčané“. Nie je to jednoducho pravda. Baktéria Escherichia coli má asi 2.000 génov, človek asi 100.000. Pravdou však je, že značné časti DNA – nazývané z tohoto dôvodu „fosílne“ gény – neplnia žiadnu funkciu.

Gény nesú obvykle niekoľko alternatív jednej vlastnosti, ktoré sa nazývajú alelami. Príkladom alel môžu byť tie, ktoré zodpovedajú za rôznu farbu očí, alebo za rôzne krvné skupiny. Sada alternatív, ktorú daný jednotlivec nesie v svojom genóme, sa nazýva genotypom; vlastnosti, ktoré sa v telesnej stavbe jednotlivca naozaj prejavia, sa nazývajú fenotypom. Vzťah medzi fenotypom a genotypom súvisí o. i. s javmi recesie a dominancie, ktoré spôsobujú, že niektoré alely, aj keď sú prítomné v genómoch oboch rodičov, sa neprejavia navonok v potomstve: modrookým rodičom sa môže narodiť hnedooké dieťa.

Vráťme sa teraz späť k vlastnej evolúcii. Živočíšne druhy môžu po mnohé generácie žiť v stacionárnom stave: jednotlivé exempláre sa od seba líšia iba v dôsledku odchýlok medzi génmi (alelami) rodičov, ktoré sa prenášajú z rodičov na deti podľa rigídnych Mendelových zákonov. U jedného sa prejaví jedna z jestvujúcich alel, u druhého iná. Z času na čas sa však vyskytnú v genetickom materiáli rodičov aj mutácie, ktoré môžu (ale nemusia) viesť k objaveniu vlastností, ktoré neboli prítomné v genetickej výbave ani jedného z rodičov, ktoré nie sú prítomné ani v jedinom exemplári daného druhu. Mutácie spôsobujú rôzne faktory, od kozmického žiarenia až po látky prítomné v organizme a dochádza k nim pri tvorbe vajíčok a spermií. Keby nebolo mutácií, vývoj by nebol možný. Mnohé mutácie sú škodlivé, ba až letálne a ak sú dominantné, z genofondu populácie sa rýchlo vytratia. Nie je ich však až tak veľa, ako radi tvrdia kreacionisti. Ak by totiž väčšina mutácií bola škodlivá, život by zakrátko zanikol. Mnohé mutácie sú neutrálne, ale sú aj také, ktoré môžu byť majiteľovi prospešné. Tu treba upozorniť na to, že prospešnosť i neutrálnosť mutácií silne závisí od situácie, v ktorej sa nachádza organizmus, ktorému sa mutácia prihodila. Predĺženie prstov u vtáka, ktorý si zriedkakedy sadne na zem, bude zrejme neutrálne, pre brodivého vtáka však bude asi prospešné. Keďže sa získaná zmena dedí teoreticky neobmedzene dlho, môže sa stať, že sa nositeľ neutrálnej mutácie dostane po dlhej dobe do prostredia, v ktorom mu bude táto mutácia veľmi prospešná. Neutrálnosť, či prospešnosť mutácie je teda vlastnosť relatívna. Tu treba ešte zdôrazniť, že v evolučnom chápaní sa mutácie považujú za náhodné len v tom zmysle, že môžu byť jednotlivcom, ktoré z mutovaných genómov vzniknú, s rovnakou pravdepodobnosťou prospešné ako škodlivé. Keďže mutácie predstavujú náhodné zmeny molekuly DNA, je dosť zrejmé, že veľké mutácie sú menej pravdepodobné, než malé, pretože veľké postihujú väčšie časti molekúl. Preto väčšina mutácií bude spôsobovať malé zmeny fenotypu a preto k väčším zmenám môže dochádzať iba kumuláciou malých zmien. Mnohé mutácie retušuje korektívny mechanizmus počas replikácie DNA, ale napriek tomu je existencia mutácií veľmi dobre potvrdeným empirickým faktom. Darwin účinok mutácií správne vypozoroval pri šľachtení a rýchlo pochopil, že proces evolúcie je proces tvorený selektovanou kumuláciou malých dedičných zmien (v našom slovníku mutácií).

Na tomto mieste treba zdôrazniť, že neznalosť genetiky spôsobovala Darwinovi problém práve preto, že sa domnieval, že znaky rodičov sa spriemerňujú, takže mal ťažkosti pochopiť, ako by sa mutácia mohla udržať po mnohé generácie párenia s nemutovanými partnermi. Pri spriemerňovaní by sa mala predsa za pár generácií stratiť a táto predstava spôsobovala Darwinovi mnohé bezsenné noci. Dnes vieme, že mutácia je trvalá zmena genómu (genetickej výbavy jednotlivca), ktorá sa nemení až do ďalšej mutácie u niektorého z jeho potomkov. Je obdivuhodné, že napriek neznalosti tohoto faktu Darwin neopustil predstavu vývoja kumuláciou malých zmien. Nedovolila mu to jeho geniálna intuícia.

Treba tu zdôrazniť, že mutácia sa stane vždy len jedinému jednotlivcovi, že mutácia nie je čosi, čo by postihlo celý druh, či väčšiu skupinu živočíchov. Už jedinou mutáciou sa jednotlivec vydal na cestu, ktorá z neho mohla urobiť predka nového druhu (species), z ktorého sa neskôr mohol stať nový rod (genus), čeľaď (familia), rád (ordo), trieda (classis), či kmeň (phyllum). Jedna jediná mutácia rozhodla o tom, že jej nositeľ sa stal praotcom mnohobunkových živočíchov, bola to len jedna mutácia, ktorá rozhodla o tom, že ten, ktorému sa prihodila, odklonil svoju budúcnosť smerom k cicavcom. Keďže nepochopenie tohoto faktu plodí mnohé vážne nedorozumenia, treba si ho veľmi jasne uvedomiť.

Druhá dôležitá, ale pritom triviálne samozrejmá vec je to, že mutácie sa dejú pred rozmnožovaním, počas gametogenézy. V princípe môžu mať rôzne spermie jedného vlka rôzne mutácie. Embryo, ktoré vznikne z mutovaného genómu, s tým počas ďalšieho vývoja nemôže už nič urobiť. Keď dospeje, môže novú vlastnosť podľa Mendelových zákonov odovzdať svojim potomkom, ale nemusí. To sú jediné alternatívy. Nič sa však na mutácii nemôže zmenšiť, ani zväčšiť. Mendelove zákony sú „binárne“, sú typu áno-nie.

Treťou dôležitou vlastnosťou mutácií je ich vysoká frekvencia, ktorú odporcovia evolučnej teórie zámerne podceňujú. Zdôrazňujú, že pravé mutácie (vsunutie, odstránenie, alebo preskupenie báz nukleotidov) sa vyskytujú v dôsledku pôsobenia enzýmov reparujúcich DNA, s frekvenciou asi len jedného prípadu z milióna na jednu bunku a jednu generáciu. Treba však uvážiť aj počet potenciálnych mutantov. Keby sa aj mutácie vyskytovali hoci len v jedinom potomkovi z milióna, pri počte niekoľko miliónov potomkov jedného druhu by sa mohli vyskytnúť aj viac než raz v každej generácii. A to celkom stačí! Argumentovanie zriedkavosťou mutácií, pri ktorom sa zabúda na obrovský počet jednotlivcov, ktoré sú im vystavené, predstavuje triviálnu logickú chybu! Ak navyše uvážime, že mutácie môžu postihnúť aj regulačné gény, ak zvážime úlohu duplikácií a rekombinácií, netreba sa nijak obávať nemožnosti dramatických zmien za miliardy rokov, ktoré mala evolúcia k dispozícii. Ale načo ťažkopádne vypočítavať frekvenciu mutácií? Dnes je už potvrdené, že priemerný človek sa rodí asi s 50-100 novými mutáciami, z ktorých sú asi 3 účinné, t. j. skutočne spôsobujú zmenu niektorého proteínu.

Genóm je stavebný plán pre tvorbu embrya. Nemutovaný genóm vytvorí bežné mláďa daného druhu. Mutovaný genóm vytvorí embryo odlišné. Odlišnosť môže byť pre mláďa tak škodlivá, že sa nedožije ani pôrodu, alebo zomrie v mladom veku.

Hrozným príkladom takej mutácie je Tay-Sachsova choroba, ktorá je dôsledkom zmeny jedinej bázy DNA, ale táto mutácia zasahuje tak hlboko do metabolizmu, že jej obeť sa dožije iba pár rokov. Len tak mimochodom poznamenávam, že táto mutácia vznikla kedysi dávno, údajne u jedného aškenázskeho Žida, odvtedy sa recesívne dedí, jej výskyt sa u rodičov dá rutinne dokázať a rovnako sa dá spoľahlivo zistiť aj u plodu. Napriek všetkým týmto možnostiam jednoznačnej detekcie, zakazuje kresťanské učenie lásky usmrtiť plod s touto vadou, a namiesto smrti v štádiu embrya mu láskavo umožní umierať dlhým dusením pri plnom vedomí, ale až v predškolskom veku.

Sú aj mutácie, ktoré na mláďati ani nepoznať a nemajú na jeho ďalší život žiaden vplyv – sú úplne neutrálne. Sú však aj také, ktoré mu nejako prospejú. Tu sa musím trocha pristaviť, pretože pojem prospech zvyknú ľudia chápať v rôznych významoch. Prospešná mutácia je taká, ktorá zvýhodní telo, ktoré ovplyvnila, a to pri získavaní potravy a množení. Prospech tu neznamená niečo, o čom by zviera vedelo. O prospechu jednej mutácie nemôže vedieť ani prípadný ľudský pozorovateľ. Pozorovať sa dá obvykle len kumulácia viacerých prospešných mutácií, až po nich je zrejmé, akou telesnou vlastnosťou mutácie jednotlivca zvýhodnili. Zmenou prostredia sa môže pôvodne neutrálna mutácia stať prospešnou, ale i škodlivou.

A tu sa približujeme ku kľúčovému pojmu Darwinovej geniálnej myšlienky, ktorá sa volá selekcia prírodným výberom a objavila sa zhruba takto. Darwin si všimol obrovský prebytok populácie každého druhu. T. R. Malthus (1766-1834) mu iba potvrdil to, čo veľmi dobre vedel aj sám: že populácia každého živočíšneho druhu rastie za prirodzených podmienok geometrickým radom. Zarazil ho nepomer medzi plodnosťou a počtom dospelých jednotlivcov. Jednoduché kupecké počty privedú každého, kto má potrebné informácie a je schopný základných aritmetických úkonov k zisteniu, že len nepatrný zlomok populácie väčšiny druhov sa dožije reprodukčného veku. Toto zistenie znamená, že prežiť v prírodných podmienkach je veľmi ťažké, že pre príliš veľa hladných úst je príliš málo potravy, že je príliš veľa dravcov číhajúcich na vašu nepozornosť, príliš veľa chorôb ktorým sa nedá uniknúť, jednoducho príliš veľa nebezpečenstiev všemožných druhov. Znamená to, že stačí drobná nepozornosť a je po vás. Keď ste divé zviera (nie miláčik svojho pána, ktorý vás kŕmi „vyváženou“ stravou Pedigree Pal), musíte mať vo dne v noci oči na stopkách už len kvôli tomu, aby ste vôbec prežili. A keď chcete splodiť potomstvo, máte príliš veľa konkurentov, ktorí túžia po tých istých samiciach.

Túto situáciu nazval Darwin bojom o život a odporcovia evolučnej teórie robia všetko čo vedia, aby tento pojem interpretovali ako podporu amorálnosti akéhokoľvek druhu. Pripomeňme si preto slová samotného autora:

„Mal by som hneď na začiatku podotknúť, že termín boj o život používam v širokom a prenesenom zmysle, a zahrnujem do tohoto pojmu závislosť jedného tvora na druhom… O dvoch psovitých šelmách v dobe hladu sa môže právom povedať, že bojujú jedna s druhou o to, ktorá dostane potravu a bude žiť. Avšak aj o rastline na okraji púšte sa hovorí, že zápasí o život so suchom… O rastline, ktorá každý rok vytvorí tisíce semien, z ktorých priemerne dospieva iba jedno, môžeme povedať, že bojuje s rastlinami toho istého druhu, alebo iných druhov, ktoré práve pokrývajú pôdu.“ (Pôvod, s. 48)

Táto situácia má ten jednoduchý dôsledok, že každá, aj tá najdrobnejšia, najnepodstatnejšia výhoda, výhoda ktorú ani len nevidno, vám môže zachrániť život, môže vám umožniť splodiť aspoň raz v živote potomstvo, ktoré do ďalších generácií ponesie vaše gény. Keby nebolo tej strašlivej konkurencie, keby nebolo boja o život, nebolo by evolúcie, nebolo by pretekov medzi stále rýchlejšími gepardmi a stále pozornejšími Thompsonovými gazelami. Mutácie, ktoré by nikto neselektoval, by boli ako chrústy rozbiehajúce sa z otvorenej papierovej krabice všetkými smermi. Keby na myš nečíhalo z každej strany nebezpečenstvo, mutant, ktorý by prišiel o sluch, by to na svojom reprodukčnom úspechu ani nezbadal. Prečo sú jaskynné živočíchy slepé? Pretože žili tak dlho bez potreby svetla, že mutácie, ktoré spôsobili stratu zraku (ale nie očí, tie zostali – povedané biblickým jazykom – aby sme vedeli, že ich niekedy mali) im nijak neprekážali pri prežití a množení. Aj antilope sa môže taká mutácia prihodiť. Veď slepota nie je zriedkavá mutácia a netreba na ňu veľa krokov: iste viete, že slepí ľudia majú veľmi často oboch rodičov vidiacich. Lenže na život ľudí nikto nestriehne, ale na slepom mláďati antilopy by si o deň dva pochutnal šakal, či hyena. Pri chove domácich zvierat sa neobjavuje viac mutantov, než u zvierat divých. Prečo ich potom tak veľa vidíme? Pretože tých s nevhodnými mutáciami nevyhubili dravce. Ratlík by v divej prírode zdochol za deň. Selekcia pôsobí aj dnes a všade. Len ju nevidno tam, kde ju reguluje boj o holú existenciu. Každá odchýlka nevhodným smerom je okamžite vyradená, rovnako ako je naopak v prípade domáceho chovu uchovaná každá odchýlka, ktorá sa páči chovateľovi, či už je zvieraťu prospešná, alebo nie.

Ale platí to aj naopak: každá odchýlka v genóme, ktorá umožní svojmu nositeľovi prežiť a splodiť potomstvo, spôsobí, že sa v potomstve uchová. Keď spôsobí hoci aj nepatrnú a drobnú prednosť, bude v populácii rásť podiel tých, ktorí ju majú. Populácie sú totiž vždy obmedzené: jeden hektár savany s rodinou levov uživí len určitý počet gaziel a preto prežitie jednej znamená, obrazne povedané, zahynutie druhej. Výskyt takmer každého nového znaku, vedie k polarizácii dovtedy rovnovážnej populácie.

Mutácie sú náhodné udalosti. Keď jedna mutácia trocha predĺži nohy, nič nezaručuje, že sa vôbec niekedy objaví iná mutácia, ktorá ich predĺži ešte trochu viac. Ale nič dramatické sa v takom prípade nestane: nohy sa jednoducho nebudú predlžovať a ak od ich predĺženia závisí život druhu, ten jednoducho vyhynie. Vyhynulo už niekoľkonásobne viac druhov než ich dnes jestvuje. Vyhynutie ktoréhokoľvek ďalšieho nebude preto znamenať žiadne čudo. Nie je však nijak vylúčené, že sa zopakujú mutácie vedúce rovnakým smerom viackrát. Treba si len uvedomiť, že ďalšia mutácia sa už deje v inom tele a s iným genómom. Toto telo je pre mutáciu rovnako „nové“ ako bolo to, v ktorom sa uskutočnila predchádzajúca mutácia. Keď sa tá prvá vyskytla s istou nenulovou pravdepodobnosťou, znamená to, že to bola mutácia v princípe možná, že jej výskyt žiadnym prírodným zákonom neodporoval a preto sa s rovnakou pravdepodobnosťou môže vyskytnúť aj tá druhá, rovnako ako pri hodoch kockou môžete dostať viackrát (nie nutne tesne po sebe) rovnaké čísla. Pravdepodobnosť postupnosti nezávislých mutácií je rovnaká ako pravdepodobnosť prvej mutácie! Ale pravdepodobnosť viacerých súčasných mutácií je rovná súčinu ich pravdepodobností: ak by jedna mutácia mala pravdepodobnosť 1/100, súčasný výskyt len dvoch mutácií by mal pravdepodobnosť 1/10000. To je triviálny fakt počtu pravdepodobnosti. Preto sú veľké a súčasné mutácie krajne nepravdepodobné. Mutácie môžu ovplyvňovať rôzne vlastnosti tela a s veľkou pravdepodobnosťou sa to nebude diať súčasne: jedna mutácia trocha predĺži nohy, o pár ďalších generácií iná mutácia trocha zvýši výkon srdca, o ďalšie generácia sa opäť môžu predĺžiť nohy, neskôr sa trochu zmení štruktúra srsti a tak to môže pokračovať neobmedzene. Dlhodobý účinok malých postupných mutácií vzdialených génov dokonale simuluje veľkú synchrónnu mutáciu. Žiadna mutácia sa neudeje nutne, v každej etape sa môže objaviť mutácia letálna, ale keďže už jestvuje väčšia populácia organizmov, letálna mutácia vykynoží iba malú časť z nich. Takým spôsobom sa môžu hromadiť odchýlky rôznych fenotypových vlastností a pomaly môžu meniť pôvodný druh na iný. Ak sú všetky odchýlky prospešné, ak dokonca ich súčasná prítomnosť podstatne zlepšuje vyhliadky nositeľa, budú v populácii prevládať. To je v stručnosti podstatná myšlienka Darwinovej evolúcie, i keď som ju podal silne zjednodušene a schematicky.



Logika kreacionizmu

Napriek tomu, že evolučnú teóriu potvrdzuje doslova všetko, je dnes ešte príliš veľa ľudí, ktorí jej neveria. Podľa nedávneho prieskumu Gallupovho ústavu, 47% dospelých Američanov verí, že všetky dnes jestvujúce živočíšne druhy stvoril boh pred menej než 10 000 rokmi. Tento demografický fakt je príliš vážny na to, aby ho bolo možné prejsť mlčaním. Tí, ktorí veria v stvorenie, sa sami nazývajú kreacionistami a svoje názory šíria a presadzujú dosť militantne. Len preto o evolučnej teórii píšem aj ja.

Kreacionisti majú proti evolučnej predstave mnoho výhrad, ktorým sa budem podrobnejšie venovať na konci príspevku. Ich postup mi väčšinou pripomína správanie inžiniera, ktorý by sa pri moste, ktorý sa práve zrútil, pokúšal vypočítať, či sa mohol zrútiť. Ak by mu výpočet ukázal, že sa zrútiť „nemohol“, vyhlásil by zrútenie za zázrak. Obrazne povedané, kreacionista viac verí svojim „výpočtom“, než faktom. Táto analógia pokuľháva za skutočnosťou len v tom, že kreacionista považuje za nemožné jednoducho to, čo si on sám nevie predstaviť, vychádzajúc zrejme z chybnej premisy, že jeho geniálny mozog si dokáže predstaviť všetko a ak si niečo predstaviť nedokáže, tak to rovno nie je možné! Dôvody pre taký postoj nakoniec do istej miery aj chápem.

Predstavte si, že by ste sa helikoptérou dostali ku skupine Papuáncov uprostred pralesov Novej Guiney. Boli by ste prvými ľuďmi bielej pleti, ktorých by videli. Ako by si podľa vás vysvetlili podstatu vašej helikoptéry? Samozrejme by ju považovali za vtáka! Vaše tvrdenie, že je to dielo človeka, by považovali za smiešne. Celý život nevideli lietať nič iné iba vtáky, a vy by ste im chceli nahovoriť, že čosi také sa dá skonštruovať? Veď oni mali po tisíce generácií skúsenosti len s konštruovaním lukov a šípov! Ale toto nie je fikcia, to je doložená pravda! Takých Papuáncov zamestnávajú v baniach na zlato a dopravujú ich do práce helikoptérou. Napriek desaťročiam skúseností s týmto lietajúcim strojom ho považujú za zázračného vtáka a pred nastúpením do jeho útrob mu prinášajú obete! Prečo by ste sa im mali diviť? Ja ich nepodceňujem, nepovažujem ich za primitívov, za zaostalých. Jednoducho v celom ich svete, telesnom i duševnom, sa nenachádza analógia, pomocou ktorej by mohli interpretovať helikoptéru ako dielo človeka. Pre nich je to vták, síce trochu divný, ale jednoznačne vták. Človek každej kultúry považuje za samozrejmé to, s čím sa denne stretáva. A človek našej kultúry – na rozdiel od kultúry Papuáncov – sa denne stretáva s produktami zámernej ľudskej činnosti. Ten vie, že helikoptéra je dielo ľudí a preto má tendenciu vysvetľovať si aj komplikované zvieratá ako produkty bytosti, podobnej človeku. Aj keď je také usudzovanie, vychádzajúce z konkrétneho kultúrneho kontextu, pochopiteľné, nie je samozrejme vždy pravdivé. Helikoptéra nie je vtákom, stvoril ju človek, ale na druhej strane vtáka nestvorila bytosť podobná človeku. Ak už žasneme nad dômyselnosťou živého tvora, máme právo si myslieť len to, že je produktom čohosi. Prečo by toto „čosi“ malo byť akurát také, akí sme my? Prečo by to mala byť nutne akási inteligentná bytosť? A ak by to už naozaj mala byť taká bytosť, prečo akurát surovo krvilačný Jahwe, ktorý kázal vyvražďovať celé národy, prečo nie inteligencia sídliaca dnes v inej galaxii a zabávajúca sa tam experimentami s novými fyzikálnymi zákonmi? Len preto, že my žijeme tu na zemi a máme tendenciu usudzovať pomocou analógií? Usudzovať môžeme, samozrejme, ako chceme, ale za pravdu by sme mali prijímať len to, čo sa dá dokázať. V tom sa predsa hádam len trochu líšime od Papuáncov, či nie?

Je dosť kuriózne, že práve genetiku používajú kreacionisti ako argument proti evolúcii, akoby naraz v diele opáta Mendela našli svoje hlavné tromfy. Na tomto mieste spomeniem len jednu zásadnú výhradu kreacionistov proti evolúcii, opierajúcu sa o mechanisticky interpretovanú genetiku. Tvrdia, že ak by sa evolúcia mala dať vysvetliť mutáciami, museli by byť mutácie veľké a museli by postihnúť súčasne viacero miest DNA dobre synchronizovaným postupom. Povedané po slovensky, tvrdia, že evolúcia si vyžaduje mutačné zázraky. Notorickým príkladom, na ktorom tieto svoje tvrdenia ilustrujú, je prípad žirafy, jej krku a mechanizmu, ktorý udržiava konštantný krvný tlak v mozgu, ktorý sa môže s hlavou dvíhať, alebo klesať o pár metrov. Celý tento príklad, aj s bombastickou a ničím nepodloženou argumentáciou, sa opiera o jediné obskúrne dielo (F. Hitching, The Neck of the Giraffe, or Where Darwin Went Wrong, Pan, London 1982). Je to čítankový príklad „dialektického“ prístupu kreacionistov k pravde a logike. Celá argumentácia kreacionistov stojí a padá s ich neschopnosťou predstaviť si, že by sa synchronizované zmeny mohli diať postupne. Len preto tvrdia, že sa zmeny dejú skokmi. Keď sa však skokom predĺži krk žirafy, skokom musí vzrásť aj krvný tlak, aby mohol dopraviť krv do vysoko položeného mozgu a skokom musí vzniknúť v tepennom systéme aj mechanizmus (niektorí hovoria dokonca o akejsi „záklopke“), ktorý bráni poklesu tlaku pri náhlom zdvihnutí hlavy. Na záver kreacionisti triumfálne vyhlásia, že taká dokonalá synchronizácia nemôže vzniknúť naraz. Circulus vitiosus ako z učebnice logiky! Premýšľajúci človek by usúdil, že všetky tieto problémy sú priamym dôsledkom predpokladu o náhlej premene nežirafy na žirafu a mali by kreacionistu viesť k záveru, že predpoklad skokovej koordinovanej simultánnej mutácie je chybný. Kreacionista však pozná „jednoduchšiu“ odpoveď: jemu tento príklad neomylne ukazuje, že žirafu v jej dnešnom tvare musel stvoriť dobrotivý pán boh, nech už je to ktokoľvek.

Nepríjemné na tomto kreacionistickom argumente je aj to, že obsahuje vyslovené výmysly. Skutočnosť je taká, že aj keď má žirafa najvyšší krvný tlak zo všetkých živočíchov (260/160), nemá žiadnu „záklopku“, ale v hlave má sieť kapilár (rete mirabile), ktoré sa pri poklese hlavy naplnia krvou a tak znížia krvný tlak v mozgu. Kreacionisti si tiež nevšimli (zrejme len nedopatrením), že žirafa dvíha a skláňa hlavu veľmi opatrne a pri sklonení hlavy (k zdroju vody) rozťahuje predné nohy, čím sa vertikálna vzdialenosť srdca a hlavy zmenšuje.

Evolucionista sa na fylogenézu žirafy díva oveľa prozaickejšie a konštatuje, že ak by sa krk žirafy predlžoval malými krokmi, tlak krvi by sa tiež mohol meniť pomaly, tomu by sa pomaly prispôsobovali cirkulačné pomery, v priebehu ktorých by sa pomaly rozrastala aj sieť kapilár v hlave a v neurónovej štruktúre mozgu žirafy by sa pomaly vytvorili reflexné spoje, ktoré by viedli k veľmi pomalým pohybom hlavy a rozťahovaniu predných nôh pri extrémnom predklone. Pravdepodobnosť takého pomalého postupu je malá, ale nenulová, takže tento postup je, keď už nič iné, tak aspoň v princípe možný. Alternatíva, ktorú ponúkajú kreacionisti, je bez božieho zásahu v princípe nemožná, ako sami priznávajú. Rozdiel medzi malou pravdepodobnosťou a nemožnosťou je však nekonečne veľký: kto netipuje, nevyhrá! Má rozumný človek opustiť možné, aj keby naozaj málo pravdepodobné vysvetlenie a s otvorenou náručou prijímať riešenie nemožné? Má kvôli prijatiu nemožného „riešenia“ uveriť v existenciu boha? Má sa veda použiť na dôkaz tvrdení odporujúcich celej vede? Veď v boha možno uveriť jednoduchšie – stačí si povedať: „verím“. Nič viac. Načo je potom potrebný toľký cirkus so žirafou a jej krkom?

Krk žirafy, bez patetickej dramatizácie tohoto prostého evolučného príkladu, predstavuje však pri evolučnej perspektíve ďalší argument v prospech tvrdenia, že evolučné zmeny musia byť v prípadoch, keď dochádza k synchronizácii zmien, veľmi pomalé. Veľká izolovaná zmena (náhle predĺženie krku bez kardiovaskulárnej kompenzácie) ohrozuje organizmus a nemôže byť teda súčasťou evolučného postupu. A prečo by mali byť náhle veľké zmeny vôbec prospešné? Veď krk žirafy sa nepredlžoval v situácii, kedy náhle zanikli nízke stromy a ich miesto zaujali stromy vysoké. Žirafy sú príbuzné bylinožravcom okapi, majú s nimi spoločného predka a ten sa vyvíjal v prostredí, kde mohli prežiť oba typy jeho potomstva: zrejme medzi stromami s lístím po celej výške stromu. Náhodné predlžovanie krku viedlo k tomu, že proto-žirafy nachádzali dostatok potravy vo vyšších výškach a preto neohrozovali potravu, na ktorú dosiahli proto-okapi. Jednoducho si tieto dva druhy „rozdelili“ zdroje potravy a keďže si nekonkurovali dramaticky, nemal vznik dnešnej žirafy tendenciu spôsobiť vyhynutie dnešného okapi. Niet tu nijakej nutnosti rýchlych zmien, netreba preceňovať ľudskú schopnosť predstaviť si všetky možné okolnosti evolučných udalostí. Veď my sa dnes môžeme iba dohadovať, za akých podmienok k evolúcii dochádzalo. Z toho, že sa nám zdá, že naša predstava o zmene podmienok vylučuje evolúciu, by sme mali predovšetkým usudzovať, že nesprávna je naša predstava.

Mnohým sa zdá, že na usmernenie vývoja treba kritérium, treba hľadisko, že treba ukázať smer, ktorým sa má zdokonaľovanie uberať. To by sa s istými okolkami dalo aj pripustiť. Čo však je niektorým ľuďom nepochopiteľné, a čo som sa snažil vysvetliť je to, že toto kritérium nemusí byť plodom inteligencie. Smer, ktorým sa bude evolúcia uberať, jej nemusí nikto predpisovať. Tendencia k neustálemu zdokonaľovaniu, trvalému zvyšovanie komplikovanosti, prispôsobovaniu okoliu a iným druhom, môže byť produktom celkom tupých, bezduchých, za žiadnym cieľom sa nepachtiacich prírodných algoritmov.

Ešte stále nechápete, že tu sme pri koreni každého účelu a zámeru? Že tu cieľ vzniká bez zámeru, zámer bez cieľa, účel bez želania a inteligencie? Kto je mutáciou znevýhodnený, zahynie a navždy sa z arény boja o život vytratí aj so svojim relatívne „vadným“ genómom. Komu sa však dostane mutácie, ktorá ho zvýhodní, môže prežiť, a jeho súrodenci budú v prípade jeho prežitia postupne hynúť. Až také je to jednoduché! Možno sa vám to zdá kruté, surové, ale nie je to o nič krutejšie, než zabíjanie miliónov kusov kuriatok, ktoré vám ugrilované tak chutia. Je to však určite jediné spoľahlivé a jediné možné riešenie. Nenadávajte na surovosť prírody – len vďaka nej ste inteligentní, poznáte rozdiel medzi dobrom a zlom, len vďaka nej ste vôbec tu! Veru, vravím vám, všetci sme stvorení na obraz tejto surovej sily a možno preto na mnohých z nás ešte vidno jej stopy.



Premena výsledku na cieľ: zrod teleológie

Na tomto mieste sa musím zastaviť, aby som sa ešte raz dôrazne vyjadril k jednému veľmi rozšírenému nedorozumeniu. Aj po veľmi dôkladnom vysvetlení evolučnej myšlienky sa ľudia opakovane pýtajú, prečo evolúcia viedla k určitému cieľu, prečo sa prispôsobenie plazov k lietaniu neskončilo pred dosiahnutím vtákov, prečo sa vtákom vyvinulo perie… Každá taká otázka neomylne signalizuje, že ten kto ju kladie, nepochopil základnú myšlienku evolučnej teórie: evolúcia nemá žiaden cieľ, má iba výsledky. V spomínanom príklade žirafy je nesprávne už aj tvrdenie, že žirafa má dlhý krk preto, aby dočiahla na vysoké konáre. Správne je vyjadrenie: žirafa má dlhý krk a preto môže žrať lístie aj z vysoko položených konárov. Analogicky, vtáky nemajú krídla preto, aby mohli lietať, ale lietajú preto, lebo majú krídla. Sú aj také, ktoré krídla nemajú (a teda nelietajú), niektoré preletia len pár metrov (vrabce), iné zotrvávajú vo vzduchu celé hodiny (dravce). V jazyku je to len drobná zmena jediného slova, ale obsah týchto výrazov je diametrálne odlišný: v prvom prípade je existencia krídel následkom (želania teleologicky vysvetliť lietanie), v druhom je príčinou (schopnosti lietať). Vidíte jasne, že v týchto dvoch formuláciách sa mení vzťah príčiny a účinku? My ľudia robíme veľké množstvo vecí preto, aby sme dosiahli ciele a asi preto ťažko odolávame pokušeniu, hľadať všade motív, cieľ, účel a klásť otázku „prečo“, ktorú sme sa naučili ešte v útlom detstve. Keď sa takým predpojatým ľudským pohľadom pozrieme späť na postupnosť, ktorá viedla od plazov k vtákom, môže sa nám zdať, že cieľom tých zmien bol lietajúci plaz – vták. Lenže vták bol iba výsledkom postupnosti zmien. Žiaden vták nemusel vôbec vzniknúť, a naopak mohli vzniknúť aj druhy pohybujúce sa hoci aj na raketovom princípe. Postupnosť vedúca od plazov k vtákom mohla skončiť hocikde uprostred, tak ako mohla pokračovať ďaleko za dnešné vtáky k „vtákom“, akých si nevieme ani predstaviť. Každý medzistupeň bol dokonalý, mohlo to ním skončiť. Vták nie je ani lepší, ani dokonalejší než plaz. Ak by naozaj bol, nežili by dnes žiadne plazy, iba vtáky. Vývoj plazov mal mnohé etapy. Každú možno považovať za výsledok, ktorý sa dá interpretovať ako cieľ – ak to veľmi chceme. Nie každá interpretácia však zodpovedá skutočnosti a teleologická interpretácia je tá, ktorá je od skutočnosti najviac vzdialená.

Neviem naozaj vôbec pochopiť, prečo sa ľudia stále a stále znovu pýšia tým, že si nevedia predstaviť, ako môže „slepá náhoda“ produkovať účelné prispôsobenie. Pokúsim sa to vysvetliť ešte raz, ale budem pri tomto vysvetľovaní už primitívne lapidárny a budem sa cítiť naozaj trápne. Náhoda nie je meno vrtošivej dámy, ktorá má nejaký zámer a svojvoľne ho realizuje. Náhoda je označenie situácie, kedy niet žiadneho zámeru u nikoho. Predstavte si, že chováte fiktívnu skupinu zvierat, ktorej bráni prístupu k potrave rad ohrád, v ktorých sú stále užšie otvory a za každou ohradou je trocha potravy. Otvory sa pritom nachádzajú vo výške, cez ktorú môže prejsť len dospelé zviera. Tie exempláre, ktoré neprejdú ani cez najširší otvor v najvnútornejšej ohrade, sa k žiadnej potrave nedostanú a celkom prozaicky zdochnú. Chcete povedať, že vydochnutie examplárov so širokým telom bol čísi zámer, že tie exempláre sa čomusi neprispôsobili? Čerta starého! Oni sa len dostali do situácie, ktorá bola v rozpore s ich vlastnosťami, do situácie, v ktorej nemohli so svojimi anatomickými danosťami prežiť. Jednoducho, medzi šírkou ich tela a šírkou otvoru, za ktorým bolo trocha potravy, bol nepomer. Taký nepomer často vytvárajú geologické zmeny (prehlbovanie koryta rieky), migrácia do iných oblastí, zmena podnebia. Pre tých, čo prejdú otvormi aj v ďalších ohradách, zostane viac potravy a budú sa množiť. Ak sa náhodou objaví genetická mutácia, ktorá spôsobí, že jej nositeľ bude ešte štíhlejší než ostatné, dostane sa ešte ďalej od najvnútornejšej ohrady, bude mať ešte viac potravy: bude si potravu môcť vyberať. Nie div, že sa bude množiť viac než ostatní, že jeho potomstvo po ňom bude väčšinou dediť štíhlosť a že teda po nejakom čase bude v populácii viac takých, ktorí budú ešte štíhlejší. Keď však k takej mutácii nedôjde, zoštíhľovanie nebude pokračovať. Evolúcia nie je nutnosť, je to iba možnosť. O jej realizácii rozhoduje náhoda len tým, že vhodné mutácie vytvorí, alebo nevytvorí. Náhodné mutácie predstavujú nutnú, ale nie postačujúcu podmienku evolúcie. Selekcia vyberá len z tých mutácií, ktoré sa vyskytnú a ktoré majú pre prežitie význam. Preto náhoda nie je sama osebe ešte konštruktívny prvok, náhoda je len množina stavebných prvkov, možností, z ktorých môže selekcia vyberať. Ak ale náhodné mutácie neposkytnú materiál pre selekciu, nebude vývoja a žiaden naivka nebude žasnúť nad „úžasne dokonalým“ prispôsobením podmienkam. Konštruktívny prvok robí z náhody až selekcia, ale tá je na jednej strane odkázaná na výber z toho, čo sa náhodou pritrafí, na druhej strane je však stále pripravená triediť. Je to celé naozaj až trápne jednoduché: Nutnou a postačujúcou podmienkou evolúcie je kombinácia náhodných mutácií so vždyprítomnou selekciou.

Mutáciami sa však nemenia iba také vlastnosti, ktoré sú v danej situácii rozhodujúce pre prežitie. V našom hypotetickom príklade sa mohla mutáciami celkom kľudne zmeniť aj rýchlosť zvierat, len si ju nikto nevšimol (ani zvieratá samé), pretože nikto v našej fiktívnej ohrade neusporiadaval preteky v behu. Je preto celkom dobre možné, že výsledná populácia štíhlych obsahuje rýchlych aj pomalých. Ak vás jedného dňa prestane zábava s ohradou zaujímať a zbúrate ju, ocitnú sa zvieratá v situácii, kde ich štíhlosť bude celkom ľahostajnou vlastnosťou. Ak sa ocitnú medzi dravcami, začne selekcia rýchlych. Ak preto zviera pozorujeme mimo prostredia, v ktorom bolo vyselektované, nemusíme ani zbadať, že je čomusi dobre prispôsobené. Adaptácia je totiž vzájomný vzťah medzi organizmom a prostredím, ktorému je daný organizmus prispôsobený. Týmto príkladom som súčasne naznačil aj to, že selekcia nemusí nutne začínať „od nuly“. Selektovať sa môžu začať variácie, ktoré v populácii už boli, iba za daných podmienok boli pre prežitie irelevantné. Zmenou podmienok sa môžu stať významnými, stanú sa východiskom pre selekciu.

Už ste si niekedy položili otázku, prečo Nobelovu cenu za fyziku nedostal zatiaľ ani jediný černoch a prečo významnú väčšinu týchto laureátov tvoria Židia? Nezdá sa vám, že tieto dve rasy sa líšia nielen výzorom a kultúrou, ale aj jemnými detailmi mozgových štruktúr? Nenapadlo vás, že gény podporujúce teoretické myslenie sa mohli u Židov začať selektovať celkom nedávno, keď im v stredovekej Európe zakázali vlastniť pôdu a tým ich vohnali do obchodu, čím sa naštartovala selekcia ľudí, ktorí sa v boji o život museli spoliehať na hlavu, nie na ruky? Ani vo sne vás nenapadlo, že sa mutácie u Židov mohli izolovať v rámci jednej rasy kultúrnym výberom, ktorý takmer vylučoval sobáše s nežidmi? Nemám žiadne dôkazy pre tento názor, ale páči sa mi táto hypotéza. Verím totiž, že selekcia prebieha aj dnes, ibaže netreba nerealisticky očakávať predlžovanie krkov žiráf za 50 rokov, ani premenu krokodíla na čajku za 1000 rokov. Možno však celkom dobre očakávať objavenie géniov výrazne prevyšujúcich priemer za pár storočí. Budúceho človeka nevytvoria tí, ktorí sa spoliehajú na stvorenie a zatvárajú oči pred eugenikou. Keď nás už slepá evolúcia obdarila inteligenciou, nemrhajme ju na stavanie snových ilúzií o posmrtnom živote, na jej popieranie, ale využime jej pochopenie na podporu vzniku inteligentnejšieho človeka.

Na záver si teda treba veľmi dobre uvedomiť, čo hovorí evolučná teória o teleológii: stavia ju z hlavy na nohy. Prispôsobenie prostrediu nie je dielom inteligentného zámeru, ale inteligentný zámer v mysli človeka je produktom slepého selektívneho procesu: prírodná selekcia po milióny rokov produkovala telá stále zložitejších zvierat, telá so stále komplikovanejšími mozgovými štruktúrami, až sa nakoniec prepracovala k mozgu človeka, ktorý sa začal pýtať na účel, zámer, cieľ všetkého možného i nemožného. Slepý algoritmus selekcie vytvoril inteligenciu, nie inteligencia vytvorila človeka! Darwinova teória poslala konečne piaty „dôkaz“ Tomáša Akvinského tam kam patrí: na intelektuálne smetisko, medzi nepodarky ľudskej mysle.



Štandardné dôkazy evolúcie

Darwin formuloval svoju predstavu o evolúcii ako vedeckú explanačnú hypotézu. Navrhol vysvetlenie, ako by vývoj živočíšnych druhov mohol prebiehať. Nie každá hypotéza však predstavuje pravdivé vysvetlenie. Vedel to aj on a preto prakticky celý život strávil jej overovaním. Trvalo mu to desiatky rokov a stále ešte nebol spokojný. Analyzoval stovky príkladov a nikde nenachádzal nič, čo by jeho hypotéze protirečilo. Dnes máme už veľmi dobré dôvody, aby sme túto hypotézu považovali za spoľahlivo potvrdenú vedeckú teóriu a odkázali kreačné mýty do ríše nesplniteľných snov z detstva ľudského rodu.

Darwin považoval svoju hypotézu za potvrdenú len tým, že ňou veľmi uspokojivo vysvetlil rozmanitosť rastlinných a živočíšnych druhov. Je to štandardný postoj exaktných prírodných vied. Ani astronómovia nemajú priame dôkazy toho, že hviezdy sú tvorené žeravou plazmou, že dvojhviezdy rotujú okolo spoločného ťažiska. Ani fyzici nikomu dnes neukazujú ako Vesmír expandoval pred 15 miliardami rokov, ani súčasnú expanziu neukazujú priamo – považujú ju za potvrdenú červeným posunom galaxií. Na potvrdenie pravdivosti teórie môže stačiť, že je jednoduchá a že vysvetlí to, na vysvetlenie čoho je určená. Hlavne keď jedinou jej alternatívou je zázrak. Prečo by mali pre Darwinovu teóriu platiť prísnejšie kritériá než pre overovanie zázrakov? Len preto, že odporuje babylonsko-sumerským mýtom? Tým predsa odporuje každá vedná disciplína.

Evolučná teória má však navyše úplnú štruktúru najnáročnejšej vedeckej teórie: a) vysvetľuje zrozumiteľným spôsobom všetky doposiaľ pozorované javy (rozmanitosť druhov), b) vysvetlenie, ktoré podáva je jednoduché (stojí len na troch princípoch), c) predpovedá, čo sa pri poznávaní nových druhov môže zistiť a čo je vylúčené aby sa zistilo a d) navrhuje falzifikáciu svojich tvrdení – uvádza fakty, ktoré by teóriu mohli vyvrátiť a z ich hľadiska ju aj neustále kontroluje. V ďalšom uvediem systematický, ale nutne stručný prehľad dôkazov v prospech tejto teórie. Podrobnosti nájde čitateľ na vynikajúcej a rozsiahlej stránke Talk.Origins.

Predtým by som ešte chcel zdôrazniť, že evolučná teória sa nevyhýba ani ďalším dôkazom, ktoré by si ktokoľvek želal predložiť. Táto teória je hádam najústretovejšia voči všetkým možným námietkam odporcov, medzi ktorých v jej prípade patria tí, ktorým sa nadprirodzené stvorenie za jeden deň zdá jednoduchším a prirodzenejším vysvetlením, než postupná selekcia mutácií za miliardy rokov. Samozrejme, že kritici by najradšej videli, ako pred ich vzácnymi očami (teraz napodiv veľmi skeptickými), z jašterov vznikajú vtáky, lenže to by si vyžadovalo vrátiť sa Wellsovým strojom času do minulosti a žiť tam pár miliónov rokov. Pri sledovaní iných argumentácií mám zasa dojem, že kreacionisti by boli spokojní až keby im niekto predviedol mutácie priamo v akcii, aby sa mohli na vlastné oči presvedčiť, že k nim naozaj došlo. Žiaľ, veda takými možnosťami nedisponuje – ale ani oni. Ani kreacionisti si neopášu zásteru a neukazujú nám: „Aha, takto boh stvoril zvieratká!“. Oni pre istotu nepredvádzajú vôbec nič.

Na úvod by som však predsa rád poskytol dva príklady, kedy sa proces selekcie mutácií deje rovno pred nosom človeka. Pripomeniem najprv, že pohlavné rozmnožovanie je podstatne väčším zdrojom premenlivosti než rozmnožovanie nepohlavné. Pri pohlavnom rozmnožovaní dochádza k spájaniu dvoch odlišných genómov, pri ktorom sa gény rôznymi spôsobmi náhodne kombinujú a premiešavajú. Pri nepohlavnom rozmnožovaní sa jednotlivec iba delí na dvoch geneticky identických potomkov, takže jediným zdrojom variability môžu byť mutácie genómu. Napriek tomu hádam každý počul o vzniku rezistencie na antibiotiká u nepohlavne sa množiacich baktérií. Keďže sa tento jav deje pri nepohlavnom rozmnožovaní, nedá sa vysvetliť ináč, než mutáciou genómu a selekciou mutovaných baktérií. Každý by mal vedieť, že k takej rezistencii dochádza dosť rýchlo (v podstate za pár rokov) na každé antibiotikum a to priamo dokazuje, že darvinovská evolúcia funguje aspoň v tomto prípade. Je pravda, že baktérie sa množia veľmi rýchlo, ale evolúcia pôsobila miliardy rokov.

Ale aj v prípade sexuálneho rozmnožovanie máme dosť prípadov vzniku a selekcie mutácií, ktoré prebiehajú pred očami ľudí.

„Alely podmieňujúce napr. rezistenciu druhu Drosophila melanogaster voči DDT majú malé individuálne účinky a je ich veľký počet, takže rezistencia predstavuje znak polygénne riadený. Pritom zodpovedajúce lokusy sú rozmiestnené vo všetkých chromozómoch. Je zrejmé, že v takých prípadoch priaznivá mutácia v jedinom lokuse nemôže viesť k podstatnému zvýšeniu rezistencie. Niektoré príklady ukazujú, že postupnou zámenou chromozómov citlivého kmeňa za chromozómy kmeňa rezistentného vzrastá postupne odolnosť voči DDT od nulovej až k maximálnej rezistencii. Úspech takejto zámeny naznačuje, že by evolučný proces mohol byť založený na selekcii chromozómov nesúcich maximálny počet lokusov obsadených priaznivými mutantnými alelalmi. Avšak selekcia neprebieha len medzi chromozómami, ale aj vnútri chromozómov, takže musíme uvažovať aj o evolučnom význame rekombinácie medzi lokusmi tohože chromozómu.“
(J. Nečásek, I. Cetl a kol.: Obecná genetika, SPN, Praha 1984, str. 391)

Domnievam sa, že dva príklady by mali stačiť, pretože o tom, čo je možné raz-dvakrát, už nemožno kategoricky tvrdiť, že to nie je možné vôbec. Viem však, že kreacionisti majú hrošiu kožu, preto uvediem ešte prehľad argumentov v prospech evolúcie, opierajúcich sa o spomínanú antikreacionistickú stránku, ktorá o. i. uvádza aj 29 dôkazov makroevolúcie. Tento mimoriadne rozsiahly zdroj spoľahlivých a serióznych informácií odporúčam každému, komu nerobí problémy čítať anglickú odbornú literatúru.

Jediný strom života

Podľa evolučnej teórie sú všetky organizmy potomkami jediného druhu zo vzdialenej minulosti, ktoré z neho vznikli procesom divergencie a vetvenia. Tvoria preto jediný „strom života“, ktorého štandardná verzia vyzerá schematicky takto:
                                  Štandardný fylogenetický strom života
Život možno charakterizovať štyrmi podstatnými vlastnosťami: replikáciou, dedičnosťou, katalýzou a metabolizmom. Všetky dnes jestvujúce druhy preto musia dediť štruktúry, ktoré realizujú tieto funkcie a tieto štruktúry si musia byť u všetkých druhov veľmi podobné. To je aj základná predpoveď genealogickej príbuznosti všetkého živého. Samostatné stvorenie každého druhu nemá dôvod viesť k takejto predpovedi.

Túto predpoveď potvrdzujú všetky doteraz zistené fakty. Všetky živé organizmy používajú polyméry. Organická chémia už umožnila syntetizovať stovky rôznych polymérov, ale život používa iba pár z nich. DNA, RNA a proteíny vo všetkých živých organizmoch majú tú istú chiralitu. Napríklad RNA má v svojich ribózových prstencoch štyri centrá chirality, čo predstavuje 16 možných stereoizomérov, ale v RNA všetkých organizmov sa vyskytuje len jediný.

Jestvuje 293 prírodných aminokyselín, avšak na stavbu molekúl proteínov sa z nich používa iba 20. Všetky známe organizmy používajú ten istý genetický kód (až na extrémne zriedkavé výnimky). Základnými metabolickými systémami všetkých organizmov sú glykolýza, cyklus kyseliny citrónovej a oxidačná fosforylácia. Zdrojom energie vo všetkých organizmoch je ATP. Všetko toto evolučná teória vysvetľuje veľmi jednoducho: keď sa raz čosi náhodou použilo a osvedčilo, nebolo to už možné zmeniť. Viete si predstaviť čokoľvek jednoduchšie?

Evolučná teória kategoricky predpovedá, že nikdy nenájdeme na Zemi žiaden druh s genetickým materiálom odlišným od DNA, že sa ani v jedinom druhu hmyzu z tisícov objavovaných ročne v amazonskom dažďovom pralese, nikdy nenájde ani jediný druh s genetickým kódom podstatne odlišným od štandardného. Za predpokladu samostatného stvorenia druhov by bolo celkom dobre možné, že by každý druh mal iný kód, pretože jestvuje 1.4 x 1070 informačne ekvivalentných kódov, ktoré by používali tie isté kodóny a aminokyseliny ako štandardný genetický kód. Táto možnosť by bola pre organizmy krajne užitočná, pretože by vylučovala medzidruhové vírusové infekcie. Nič také však nebolo pozorované a teória spoločného pôvodu také pozorovanie vylučuje.

Univerzálne gény

Jestvujú gény, ktoré majú všetky živé organizmy, pretože realizujú veľmi základné životné funkcie. Nazývajú sa „všadeprítomné“ (ubiquitous), alebo univerzálne. Biologický účinok sekvencií proteínov, ktoré tieto gény vytvárajú, je vo všetkých druhoch (od baktérií po človeka) rovnaký. Tieto gény však kódujú mimoriadne veľký počet rôznych, ale funkčne ekvivalentných sekvencií proteínov, a preto niet a priori žiadneho dôvodu, prečo by mal mať každý organizmus podobnú, alebo dokonca tú istú sekvenciu proteínov. Žiadna špecifická sekvencia nie je v žiadnom organizme funkčne nutná. Stačí jedna z veľkého počtu funkčne ekvivalentných foriem daného univerzálneho génu, alebo proteínu. Dôvodom je najmä funkčná redundancia proteínových sekvencií a štruktúr, ktorá stručne povedané znamená to, že jednu a tú istú funkciu môžu plniť veľmi odlišné proteíny. Jav funkčnej redundancie je veľmi všeobecný a pozorujeme ho vo všetkých známych proteínoch a génoch, bez ohľadu na druhy.

Jediným mechanizmom, ktorý môže spôsobiť, že dva odlišné organizmy majú univerzálne proteíny s podobnými sekvenciami, je dedičnosť. Z toho všetkého vyplýva, že organizmy s podobnými sekvenciami univerzálnych proteínov (a teda s podobnými univerzálnymi génmi) sú príbuzné a čím sú podobnejšie, tým je príbuzenstvo bližšie. Možno ich teda použiť na zistenie genealogickej príbuznosti rôznych druhov.

Jedným z takých esenciálnych a univerzálnych proteínov je cytochróm c. Obsahujú ho mitochondrie buniek, kde prenáša elektróny v základných metabolických procesoch oxidačnej fosforylácie. Ľudský cytochróm c funguje vynikajúco aj v kvasinkách napriek tomu, že sa od ich cytochrómu líši vo viac než 40% tohoto proteínu. Na jeho plnú funkčnosť stačí asi tretina z jeho 100 aminokyselín. Nedávne výpočty ukázali, že jestvuje minimálne 2.3 x 1093 možných a funkčných proteínových sekvencií cytochrómu c. Toto číslo je asi miliardkrát väčšie než počet atómov vo viditeľnej časti Vesmíru. Preto počet možných plne funkčných variantov cytochrómu c je prakticky neobmedzený a preto niet a priori žiadneho dôvodu, prečo by mali mať dva odlišné druhy zhodné, alebo podobné proteínové sekvencie cytochrómu c.

Ak by teda človek a šimpanz boli na sebe nezávislí, nemala by medzi ich cytochrómami jestvovať ani tá najmenšia korelácia. Teória spoločného pôvodu a štandardný fylogenetický strom však naproti tomu predpovedajú, že človek a šimpanz sú blízki príbuzní. Preto predpokladáme, že sekvencie v cytochróme c človeka a šimpanza budú podobnejšie, než napríklad medzi človekom a kvasinkami, jednoducho v dôsledku dedenia príslušného génu.

Táto predpoveď evolučnej teórie je potvrdená zistením, že človek a šimpanz majú presne zhodnú proteínovú sekvenciu cytochrómu c. Ak by mala byť táto zhoda náhodná, jej pravdepodobnosť by bola menšia než 10-93 (1 ku 1093). Táto pozoruhodná zhoda proteínov preto potvrdzuje teóriu spoločného pôvodu človeka a šimpanza. Navyše, rozdiel medzi cytochrómom človeka a ostatných cicavcov je iba v desiatich aminokyselinách, čo by pri náhodnom vzniku malo pravdepodobnosť iba 10-29. Kvasinka Candida krusei je jedným z človeku najvzdialenejších eukaryotov, ale líši sa od ľudského cytochrómu v 51 aminokyselinách, čo za predpokladu náhody dáva pravdepodobnosť menšiu než 10-25.

Ak by proteínové sekvencie cytochrómu c boli u rôznych druhov rôzne, predstavovalo by to veľmi silný dôkaz v prospech nezávislého (možno aj súčasného) vzniku druhov.

Pseudogény

Pseudogény sú veľmi príbuzné funkčným génom, až na to, že buď majú chybné regulačné sekvencie, alebo majú vnútorné stop-kódy, ktoré blokujú tvorbu korešpondujúcich proteínov. Sú teda nefunkčné a keď sa odstránia, neovplyvňujú fenotyp organizmu. Ak nie sú rudimentárne, vznikajú duplikáciou a následnou mutáciou. Bolo pozorovaných veľa procesov, ktoré duplikujú gény, vrátane transpozičných udalostí, chromozomálnej duplikácie a nerovnomerného crossing-overu chromozómov. Duplikácie génov predstavujú zriedkavé a náhodné udalosti, ale každá duplikovaná DNA sa dedí. Ak teda nájdeme ten istý pseudogén na tom istom mieste chromozómu u dvoch druhov, predstavuje to silný dôkaz pre ich spoločný pôvod.

Jestvuje veľa príkladov spoločných pseudogénov medzi primátmi a ľuďmi. Jedným z nich je gén ψη-globínu, pseudogén hemoglobínu. Majú ho spoločný iba primáty presne na tom istom mieste chromozómu a znefunkčňujú ho tie isté mutácie. Iným príkladom je gén steroidnej 21-hydroxylázy. Ľudia majú dva exempláre tohoto génu: funkčný a nefunkčný pseudogén. Inaktivácia funkčného génu vedie ku kongenitálnej adrenálnej hyperplázii, ktorá predstavuje zriedkavú a vážnu genetickú chorobu. Tento pseudogén je u šimpanza i človeka nefunkčný z tej istej príčiny: vymazanie toho istého lokusu.

Rudimenty a atavizmy

Rudimenty predstavujú zakrpatelé štruktúry, ktoré kedysi u predkov plnili nejakú funkciu. Keďže dnes neplnia žiadnu funkciu, iné vysvetlenie ich prítomnosti, než to, že predstavujú zbytky kedysi funkčných štruktúr, nedáva zmysel. Príkladmi sú rudimentárne panvy pytónov, nefunkčné nohy niektorých plazov, zbytky očí jaskynných rýb, appendix človeka. Všetky príklady rudimentov sa dajú vysvetliť pomocou funkcií, ktoré vykonávali u predkov. Štandardný fylogenetický strom poskytuje ohromný počet predpovedí o rudimentoch, ktoré sú možné a o takých, ktoré sú pre daný druh nemožné.

Z definície rudimentov vyplýva, že by sme u obojživelníkov, vtákov ani plazov nikdy nemali nájsť rudimentárnu placentu, ani prsné bradavky. Nemali by sme nájsť rudimentárne perie u cicavcov, nemali by sme nájsť ani článkonožce s rudimentárnou chrbticou. To sú predpovede evolučnej teórie. A tieto predpovede sa naozaj plnia, pretože sme nič také nenašli. Ak sa však čosi také zistí, bude evolučná teória vyvrátená. Robí kreacionizmus také predpovede? Hľadá kreacionizmus také metódy falzifikácie? Prečo nie?

Rudimenty sa vyskytujú aj na molekulárnej úrovni. Ľudia nie sú schopní syntetizovať vitamín C. Avšak predpokladaní predkovia ľudí túto schopnosť mali, tak ako ju má väčšina živočíchov okrem primátov a morčiat. Preto sa predpokladalo, že ľudia, ostatní primáty a morčatá by mohli mať dôkazy tejto stratenej funkcie ako molekulárny rudiment.

Nedávno sa tento predpoklad potvrdil: u ľudí a morčiat bol nedávno objavený gén L-gulano-g-laktonovej oxidázy, potrebný na syntézu vitamínu C (Nishikimi, Fukuyama et al. 1994). Jestvuje ako pseudogén, ktorý nie je schopný funkcie.

Veľké množstvo iných príkladov možno nájsť na stránke venovanej argumentom v prospech makroevolúcie, opierajúcich sa špeciálne o históriu vývoja organizmov.

Za atavizmus považujeme znovuobjavenie strateného znaku charakteristického pre vzdialeného evolučného predka, ktorý nebol pozorovaný u rodičov, ani blízkych predkov organizmu, u ktorého sa atavizmus neočakávane vyskytol. Ďalšou charakteristikou atavizmu je to, že sa má vyskytovať u dospelého jedinca a že je v populácii mimoriadne zriedkavý. Bez evolučnej perspektívy by sme atavizmus nemohli identifikovať a preto nás zaujímajú hlavne potenciálne atavistické štruktúry, ktoré sú charakteristické pre taxonomické jednotky, do ktorých jednotlivec s atavizmami nepatrí. Ak by sa napríklad niekedy objavil hypotetický kôň so žiabrami, považovali by sme to za potenciálny atavizmus, lebo žiabre sú charakteristické pre kmeň rýb, do ktorého kone nepatria. Žiadny organizmus nemôže mať atavistické štruktúry, ktoré sa nikdy nevyskytovali u jeho predkov. Štandardný fylogenetický strom dáva pre každý druh obrovské množstvo predpovedí o atavizmoch, ktoré sú pre daný druh „povolené“ a takých, ktoré sú uňho vylúčené. Na úrovni genetických mutácií možno atavizmy vysvetliť ako mutácie, ktoré odblokovali dlho zablokované gény, zodpovedné za znaky prejavujúce sa vo fenotype ako atavizmus.

Ľudia predstavujú z celkom pochopiteľných dôvodov najznámejší živočíšny druh a preto u nich poznáme najviac anomálií. Jedným z najpozoruhodnejších atavizmov je zriedkavý „pravý ľudský chvost“, nazývaný niekedy aj „rudimentárny chvost“. Odborná literatúra popisuje viac než 70 prípadov pravých ľudských chvostov (Matsuo et al. 1993). Tieto anomálie sa vyvíjajú z najdistálnejšieho konca embryonálneho chvosta, ktorý pozorujeme u každého embrya. Pravý ľudský chvost je charakterizovaný zložitým usporiadaním adipózneho a pojivového tkaniva, centrálnymi zväzkami pozdĺžne usporiadaného priečne pruhovaného svalstva v jadre, prítomnosťou ciev, nervových vlákien, gangliových buniek a špecializovaných nervových orgánov citlivých na tlak (Vater-Paciniho telieska). Je pokrytý normálnou kožou s vlasovými folikulami a mazovými žľazami. Dĺžka takého chvosta u novorodenca (priemerná dĺžka tela novorodenca s vystretými nohami je okolo 50 cm) sa pohybuje od troch do 13 cm a chvostom možno pohybovať a sťahovať ho. Hoci takýmto chvostom obvykle chýbajú skeletálne štruktúry, vyskytli sa aj chvosty s chrupavkou a viacerými samostatnými stavcami. V tejto súvislosti treba zdôrazniť, že chvostové stavce nie sú nutnou súčasťou chvostov stavovcov (viď prípad primáta Macacus sylvanus, ktorého chvost nemá ani jeden stavec). Pravé ľudské chvosty sa aj dedia, hoci zriedkavo. Podobne ako u iných atavistických štruktúr, ľudské chvosty sú veľmi pravdepodobne výsledkom somatickej alebo germinatívnej mutácie, ktorá reaktivuje vývojovú líniu, ktorá sa zachovala v ľudskom genóme.

Netreba, myslím si, zdôrazňovať, že výskyt pravého ľudského chvosta musí šokovať kreacionistov. Príkladom je Duane Gish, ktorý napísal často citovaný článok „Evolúcia a ľudský chvost“. Opiera sa v ňom výlučne o jeden prípad nepravého ľudského chvosta, na základe ktorého chybne usudzuje, že atavistické ľudské chvosty sú „iba anomálne malformácie, ktoré nemajú nič spoločné s imaginárnym predkom“.

Embryológia

Na základe štandardného fylogenetického stromu môžeme očakávať v niektorej etape embryonálneho vývoja cicavcov žiabrové štrbiny, alebo vaječné škrupiny (a aj ich pozorujeme) a môžeme očakávať ľudské embryá s chvostami (aj tie nachádzame). Avšak nikdy neočakávame, že by sme mohli nájsť prsné bradavky, vlasy, alebo placentu v embryu ryby, obojživelníka, alebo plaza. Podobne môžeme očakávať zuby u niektorých vtáčích zárodkov (a naozaj ich aj pozorujeme), ale nikdy neočakávame, že nájdeme zobáky v embryách cicavcov podtriedy Eutheria. Majú kreacionisti takéto predpovede? Prečo nie? Ako si vysvetľujú túto jednosmernosť fylogenetického stromu svojou geniálnou kreačnou „hypotézou“?

Genetické zmeny

V prírode i v laboratóriu sa pozorovali rozsiahle genetické zmeny. Vedci boli svedkami nevratnej a dedičnej zmeny genómov spôsobených rôznymi javmi, vrátane toku génov, náhodného genetického posunu, prírodného výberu a mutácií. Pozorované mutácie boli spôsobené mobilnými intronmi, duplikáciou génov, rekombináciou, transpozíciami, retrovirálnymi vsunutiami (horizontálny prenos génov), substitúciami báz, odstránením aj pridaním báz a preusporiadaním chromozómov. Medzi posledne menované patria duplikácia genómu (napr. polyploidia), nerovnomerný crossing-over, inverzie, translokácie, štiepenie, fúzia báz (Futuyma 1998, pp. 267-271, 283-294).

Druhotvorba

Od začiatku 20. storočia bolo u rastlín zaznamenaných mnoho druhotvorných udalostí pôsobením hybridizácie a polyploidizácie. Pozorovalo sa aj niekoľko druhotvorných udalostí bez tohoto mechanizmu (kukurica a S. malheurensis).

Rozsiahlo sú dokumentované mnohé druhotvorné zmeny u druhu Drosophila spôsobené špecializáciou habitatu, zmenou reprodukčného správania a inými mechanizmami.

U zelených rias bol zaznamenaný prechod od jednobunkovosti k mnohobunkovosti a k morfologickým zmenám z krátkych stoniek na dlhé pôsobením selekčného tlaku.

Druhotvorba sa pozorovala aj u cicavcov. Šesť prípadov druhotvorby Madeirskej myši za posledných 500 rokov bolo dôsledkom iba geografickej izolácie, genetického posunu a chromozomálnych fúzií. Jediná chromozomálna fúzia predstavuje jediný genómový rozdiel medzi ľuďmi a šimpanzmi (Britton-Davidian, Catalan et al. 2000).

Morfologická a genetická rýchlosť zmeny

Pozorované rýchlosti evolučných zmien v moderných populáciách musia byť pochopiteľne väčšie než rýchlosti pozorované vo fosílnych záznamoch. V roku 1983 Phillip Gingerich publikoval známu štúdiu 512 pozorovaných rýchlostí evolúcie. Jeho analýza sa sústredila na rýchlosti pozorované v troch skupinách údajov: 1) laboratórne experimenty, 2) historické kolonizačné udalosti a 3) fosílne záznamy. Užitočnou jednotkou evolučnej rýchlosti je darwin, ktorý je definovaný ako e-násobok zmeny charakteru organizmu (e označuje Eulerovo číslo) za milión rokov. Priemerná rýchlosť pozorovaná vo fosílnych záznamoch bola 0.6 darwinov; najväčšia rýchlosť bola 32. Táto posledná hodnota predstavuje najdôležitejšie číslo pre porovnávanie, pretože rýchlosti evolúcie pozorované v moderných populáciách majú byť najmenej také.

Priemerná rýchlosť evolúcie pozorovaná v historických kolonizačných udalostiach vo voľnej prírode bola 370 darwinov. Absolútne najväčšia rýchlosť zistená v kolonizačných udalostiach bola 80 000 darwinov. Rýchlosti evolúcie pozorované v laboratórnych experimentoch boli ešte presvedčivejšie: v priemere od 60 000 do 200 000 darwinov (čo je vyše 6000-násobok požadovanej rýchlosti).



Spoločnými chybami proti kreacionizmu!

Doteraz uvedené dôkazy neboli úplne imúnne voči mnohým trápnym argumentom kreacionistov. Nedávno sa však v molekulárnej genetike objavil veľmi silný argument, ktorý by podľa môjho názoru mal umlčať všetkých kreacionistov, ktorým zostali ešte aspoň zbytky súdnosti.

Evolucionisti tvrdia, že podobnosti medzi vlastnosťami napr. ľudí a opíc odrážajú fakt, že tieto znaky boli zdedené od spoločného predka; že teda podobnosti znakov ľudí a opíc sú spôsobené modernými kópiami génov, ktoré kedysi jestvovali v druhu, ktorý bol ich spoločným predkom. Kreacionisti tvrdia, že opice a ľudia boli stvorení nezávisle, ale boli dobrotivým stvoriteľom vybavení podobnými vlastnosťami, aby mali podobné funkcie. Oba názory, samozrejme, vysvetľujú pozorovanú podobnosť (podobne ako materializmus a solipsizmus poskytujú rovnaké predpovede o svete) a preto treba rozhodnúť, ktorý z nich je správny, napriek kŕčovitej absurdnosti kreacionistického postoja. Ja sám by som nemárnil svoju energiu vyvracaním takého “alternatívneho názoru”, skôr by som žiadal kreacionistov, aby toľkú absurdnosť dokázali oni. Viem, že by som sa nedočkal, lebo kreacionisti zo zásady nič nedokazujú – oni tu predsa nie sú na to. Som preto rád, že sa na túto prácu podujal Edward E. Max, a v ďalšom poskytujem čitateľovi silne skrátenú verziu jeho naozaj dômyselnej argumentácie.

Pri ochrane autorského práva sa občas stáva, že treba pred súdom dokázať, že dielo jedného autora je kópiou diela autora iného. Plagiátorstvo sa dokáže, ak sa v kópii nájdu tie isté chyby ako v origináli. Niektorí vydavatelia takých diel, ako sú tabuľky hodnôt špeciálnych funkcií, do nich zámerne vsúvajú drobné chyby, ktoré si dobre poznačia, aby v prípade potreby mohli usvedčiť „pirátov“. Poznám prípad tabuliek integrálov sovietskych autorov Ryžika a Gradštejna (presné bibliografické údaje už nepoznám, lebo mi túto knihu dávnejšie ktosi ukradol – zrejme kolega), ktoré boli takto „ošetrené“ v americkom vydaní. Autori programu Maple, ktorý umožňuje analyticky (metódami tzv. symbolickej algebry) počítať integrály a riešiť diferenciálne rovnice, na nich skúšali účinnosť svojho programu a s nadšením publikovali zistenie, že ich program predstihol ľudských autorov tabuliek. Ukázalo sa však, že program odhalil iba zámerné chyby vydavateľa.

Molekulárnu genetiku možno použiť rovnakým spôsobom na potvrdenie príbuznosti vzdialených živočíšnych druhov. Stačí ak sa v ich genómoch nájde zopár rovnakých „chýb“. Keďže sú to „chyby“, môžu sa vyskytovať len v nefunkčných častiach DNA a dajú sa „zdravým sedliackym rozumom“ vysvetliť ako dôsledok dedenia od spoločného predka, teda ako argument proti nezávislému stvoreniu tých druhov, ktoré ich majú spoločné. Takéto spoločné chyby sa našli u človeka a u opíc.

V tomto kontexte budeme pojmom „chyba“ označovať akýkoľvek znak DNA, o ktorom jestvujú dobré dôvody predpokladať, že 1) má pôvod v genetickej „nehode“; 2) neposkytuje organizmu, ktorý ho prenáša, žiaden úžitok; a 3) preto sa nedá rozumne interpretovať ako zámerne „skonštruovaný“. Jestvuje niekoľko navzájom sa prekrývajúcich tried takých „chýb“ a z nich sú najdôležitejšie pseudogény, ktoré už boli spomínané, a retropozóny.

Kreacionisti bežne tvrdia, že vlastnosti, ktoré pozorujeme v DNA moderných druhov – vrátane opakujúcich sa sekvencií – boli vytvorené inteligentným tvorcom. Vedci naproti tomu považujú tieto „tandemové“ sekvencie za výsledok náhodných duplikácií DNA. Jedným z argumentov v prospech vedeckého názoru je ten, že aj dnes vidíme príklady výskytu takých genetických nehôd v DNA bez božieho zásahu, hlavne v prípadoch, kedy spôsobujú choroby.

Digitálna interpretácia evolúcie

Vzhľadom na stále viac sa rozširujúcu „počítačovú gramotnosť“ mladej populácie som usúdil, že nemôže zaškodiť, ak evolučnú teóriu vysvetlím v jazyku programov, inštrukcií, pamätí. Tým skôr, že informácia, ktorú nesie DNA, je v konečnom dôsledku izomorfná digitálnej informácii. Veď už jestvuje celá rozsiahla oblasť teórie neurónových sietí, ktorá nesie názov genetických algoritmov, ktorá na takomto prístupe stojí.

Pamäť počítača delíme bežne na ROM a RAM. Skratka ROM pochádza z výrazu „read only memory“, čo zhruba označuje to, že je to pamäť, do ktorej sa informácia vloží len raz (napríklad „napálením“ CD), ale čítať sa môže potom neobmedzene často. Informácie v ROM sa už nedajú dodatočne editovať, sú tam uložené raz navždy. DNA má všetky vlastnosti ROM. Jej obsah sa „napáli“ raz (pri vzniku bunky, v jadre ktorej sa nachádza v chromozómoch) a v priebehu života jednotlivca sa už nemôže zmeniť, môže sa však ľubovoľne často čítať. K takému čítaniu dochádza pri každom delení bunky.

Nato, aby sme z akejkoľvek pamäte mohli čítať, musíme ju adresovať, teda označiť všetky miesta, v ktorých sa informácie nachádzajú, nejakými značkami. Na konkrétnej adrese sa potom nachádza konkrétny obsah pamäte. Aj DNA si možno predstaviť ako adresovanú ROM: jednoducho si predstavte, že sa lokusy chromozómov očíslujú tak, aby rôzne miesta mali rôzne čísla. Dostanete tak vzájomne jednoznačné zobrazenie medzi radom prirodzených čísel a lokusmi genómu jednotlivca. Všetci ľudia potom majú tú istú množinu adries, ale obsahy jednotlivých adries môžu byť rôzne. Práve tým sa jednotlivci od seba líšia.

Iné druhy však majú iné adresy. Napríklad šimpanzy majú 48 chromozómov, na rozdiel od ľudí, ktorí ich majú 46. Preto nemožno bezprostredne porovnávať adresy genómu človeka a šimpanza. Oba primáty však majú v svojom genóme spoločné veľké zhluky podobných obsahov, ktoré sa dajú identifikovať ako v podstate zhodné, napriek tomu, že pre oba druhy nemožno použiť ten istý systém adresovania. Dalo by sa povedať, že druh možno definovať ako množinu exemplárov s rovnakým systémom adresovania DNA.

Raz za uhorský rok sa však zmení aj adresovací systém. So šimpanzmi máme spoločného predka, takže niekde v našej spoločnej prehistórii muselo dôjsť k zmene počtu chromozómov: buď sme my stratili jeden chromozóm (zlúčením dvoch), alebo šimpanzy získali jeden (rozštiepením jedného). Musel preto jestvovať aspoň jeden exemplár, ktorý od svojich rodičov získal odlišný počet chromozómov.

V genetickom systéme dochádza príležitostne aj k iným celkovým zmenám. Celé úseky kódu sa môžu občas prekopírovať na úplne odlišné chromozómy. Vieme o tom preto, lebo na chromozómoch nachádzame rozptýlené dlhé identické úseky „textu“ DNA (viď Richard Dawkins, Slepý hodinář, Paseka, Praha 2002, str. 128).

< ===== pokračovanie =====>



Najbežnejšie fundamentalistické námietky voči evolúcii

Niektorí veriaci sa však za žiadnu cenu nechcú zmieriť s predstavou, že by ich evolučná teória mala obrať o druhé miesto vo Vesmíre (hneď po bohu) a preto jej odmietajú veriť napriek množstvu dôkazov. Neveriť sa samozrejme dá rovnako ľahko ako veriť a s vierou majú veriaci bohaté skúsenosti. Hojne ich preto využívajú pri formulovaní svojich výhrad k evolučnej teórii, ktoré predstavujú pestrú zmes dôvodov, od čisto emocionálneho odporu k predstave, že „človek pochádza z opice“, až po rafinované zneužívanie poznatkov biológie.

Veriaci kreacionisti sa pri svojej kritike v prvom rade dopúšťajú veľmi nespravodlivého postoja k tejto teórii: žiadajú, aby jej pravdivosť bola overená oveľa náročnejšie než pravdivosť iných teórií, ktorým veria. Celkom dobre ich viem pochopiť: veď v stávke je ľudská pýcha na seba samého, postavenie koruny tvorstva, hrdosť aj toho najtupejšieho z davu na vlastnú inteligenciu (božského pôvodu!). Nikto z nich molekuly nevidel a predsa mnohí bez problémov veria, že jestvujú, rovnako veria v existenciu gravitačného a elektromagnetického poľa. Veria však aj vo vírusy a baktérie, veria že choroby spôsobujú tieto živé organizmy a nie hnev boží – ten už iba oslabuje imunitu niektorých hriešnikov (s výnimkou chorôb, proti ktorým boli zaočkovaní – tu je napodiv aj hnev boží bezmocný). Hlavne však zabúdajú na to, že robia výber medzi dvomi vysvetleniami vzniku života a jeho rozmanitosti: zázrakom a prirodzeným vysvetlením. Nechcem tu do omrzenia robiť reklamu jednému františkánskemu mníchovi a jeho britve, ale zabúdajú na toto vysvetlenie aplikovať postulát, ktorý by sme v modernom jazyku mohli formulovať tak, že akékoľvek neprotirečivé prirodzené vysvetlenie je vždy lepšie než vysvetlenie zázračné – a stvorenie, ktoré predpokladá existenciu dobrotivého pána boha, je zázračné par excellence. Neviem si väčší zázrak ani len predstaviť.

Často sa stretávam s námietkou, že táto hypotéza hypotézou aj zostala a nič ju nepotvrdzuje. Veriaci mi vytýkajú, že jej verím iba tak, ako oni veria v stvorenie druhov za jeden deň. Takáto námietka si vyžaduje naozaj seriózne zváženie a preto sa ňu pozrieme podrobnejšie.

< ====== o potvrdzovaní fyzikálnych hypotéz =====>

Vidíme teda, že Darwinova hypotéza spĺňa všetky nároky kladené na vedeckú hypotézu a pre jej potvrdzovanie platí to, čo platí napríklad aj pre hypotézy fyzikálne. Jedno špecifikum predsa však len má: neumožňuje predpovedať javy, ktoré by sa mohli overovať v budúcnosti. Ale vlastne nakoniec aj umožňuje, keď budeme predpovedanie chápať primerane veci, ktorú vysvetľuje. Evolučná teória môže predpovedať, že ak sa druh D vyvinul z predka P, kdesi medzi nimi jestvoval medzičlánok M. Môže predpovedať ako ten medzičlánok vyzeral, čím sa živil, aký spôsob života viedol. No a možno čakať na šťastnú náhodu, že paleontológovia taký medzičlánok niekedy nájdu. Rozhodne však od evolučnej teórie nemožno očakávať to, čo si želajú veriaci.

< ===== pokračovanie =====>

Honba za chýbajúcimi „medzičlánkami“

Priamym dôsledkom Darwinovej teórie, ktorá považuje zmenu živočíšnych druhov za dôsledok kumulácie malých zmien, je to, že ak z druhu A za geologicky dlhú dobu vznikol druh B, musí byť táto cesta posiata veľkým množstvom druhov, ktoré ležia anatomicky (fenotypovo) medzi A a B. Táto nepochybne pravdivá predstava je napádaná z dvoch strán. Jednak vraj fosílie nepotvrdzujú takú postupnosť medzičlánkov a jednak sú medzičlánky (tak ako si ich predstavujú odporcovia evolúcie) málo životaschopné, aby mohli svoju funkciu plniť. Slovami jedného čitateľa:

„Přeměna nohy v křídlo musí překonat nevýhodnou polohu, kdy to již není noha, ale ještě není křídlo (obdobně přeměna šupin v peří), kdy se s ní už nedá dobře lézt a ještě se nedá dobře létat (únik před dravci, ochrana před změnami počasí). V podstatě každá pomalá přeměna takovéhoto rázu skrývá velké nebezpečí vyhynutí (a tedy nedokončení změny), jednak pro vyšší zranitelnost, jednak pro nutnost vyzkoušení dalších souvztažných změn.“

V tomto citáte mi nie je jasné, odkiaľ má jeho autor také suverénne informácie o tom, že predkovia vtákov mali nepriateľov, pred ktorými potrebovali unikať akurát lietaním, či lezením, ale už nie behom na zadných nohách. Tiež sa mi nezdá, že by ich perie, či šupiny mali chrániť pred nepriazňou počasia. Ak by som sa odvážil pustiť do hypotéz takého typu, skôr by som povedal, že perie znižovalo hmotnosť tvora a hlavne jeho krídel a malo zmenšovať odpor proti mávaniu krídlami. Lenže ja som v časoch Archaeopteryxa nežil, preto sa k takým hypotézam nevyjadrujem. Hlavne však považujem argumentáciu hypotetickými podmienkami na jednej strane za naivnú a na strane druhej za príliš sebaistú.

Na námietku neprítomnosti medzičlánkov medzi fosílnymi nálezmi odpovedal už Darwin poukazom na to, že fosílie predstavujú náhodný výber malého rozsahu z veľkého množstva kedysi žijúcich foriem. Túto odpoveď možno doplniť ešte tým, že túto požiadavku kladú odporcovia evolúcie veľmi neserióznym spôsobom. Ak by jestvoval len človek a prvoky, kreacionisti by triumfovali: chýbajú akékoľvek medzičlánky! Keby ste medzi prvokov a človeka vložili ryby, triumfovali by naďalej: málo medzičlánkov! To isté by sa stalo, keby ste medzi ryby a plazy vložili obojživelníky. Triumfujú aj keď im medzi plazy a vtáky vložíte päť fosílií Archaeopteryxa. Ako to vysvetliť? Veľmi jednoducho. Medzičlánok nedefinujú ako čosi, čo má byť v istej vopred definovanej vzdialenosti medzi dvomi druhmi, ale ako čosi, čo im ešte stále chýba medzi dvomi druhmi, či už známymi článkami, aby ich to presvedčilo. Medzičlánok je pre nich definovaný ad hoc, ako niečo, čo im máte vy predložiť, ak chcete aby vám uverili. Len čo im to však predložíte, zbadajú, že im opäť čosi chýba a preto od vás žiadajú ďalšie medzičlánky ex post. Pridávaním medzičlánkov by ste kreacionistu uspokojili hádam až vtedy, keby medzičlánky od seba nevedel odlíšiť. Potom by pre vás zrejme našiel inú úlohu (možno by od vás chcel, aby ste mu vysvetlili „ako sa mohli“ zmeniť gény). On totiž nemá kritérium pre pravdu, lebo on pravdu nehľadá, on má svoje silné presvedčenie, že len stvorenie je pravdivé vysvetlenie a všetky pokusy vyvrátiť mu toto presvedčenie považuje za osobný útok na seba. Veľká škoda, že on sám sa nenamáha poskytnúť žiadne argumenty pre svoju vieru v inteligentného tvorcu. Argumentom preň je to, že vy ste mu neukázali také medzičlánky, aké si on podľa svojho rozmaru zaželal.

Hľadanie medzičlánkov predstavuje len predstieraný záujem porozumieť evolúcii. Celkovým výsledkom evolúcie je totiž divergencia potomkov z predkov. Vývoj nepredstavuje súbor paralelných línií, ale skôr čosi ako vejár. Hmyzožravce, netopiere, hlodavce i ľudia, nie sú vo vzťahu predkov a potomkov, ale majú spoločných predkov. Ani len netopiere nevznikli z myší i keď sú im veľmi podobné. Kreacionisti vás však nútia aby ste ten vejár vysvetľovali ako postupný rad potomkov.

Nepochopenie, týkajúce sa neprítomnosti prechodných fosílií, sa udržiava sčasti aj bežným spôsobom uvažovania o kategóriách. Keď ľudia uvažujú o takých kategóriách ako „pes“, alebo „komár“, často podvedome veria, že každú kategóriu ohraničuje dobre definovaná hranica, alebo že jestvuje istá večná ideálna forma (pre filozofov: platonická idea), ktorá túto kategóriu definuje. Taký spôsob uvažovania vedie ľudí k tomu, že vyhlasujú, že Archaeopteryx je „100%-ný vták“, aj keď je úplne jasné, že má zmes znakov vtáka a plaza (a v skutočnosti má viac znakov plaza). Treba si uvedomiť, že kategórie sú iba umelé diela človeka. Príroda nie je povinná riadiť sa nimi, a ani sa nimi neriadi.

< ===== pokračovanie =====>

Veľmi obľúbenou námietkou je tvrdenie, že malé zmeny nemohli predstavovať evolučnú prednosť („5 % oka je nanič“).

< ===== pokračovanie =====>

Podobnú námietku predstavuje tvrdenie, že nato, aby mutácie čosi dosiahli, museli pôsobiť synchronizovane, čo „samozrejme“ nie je možné (výhra v Športke predstavuje typickú možnú analógiu takej nemožnosti – zhodnotenie pravdepodobnosti mutácií).

< ===== pokračovanie =====>

Niektorí ľudia (tu už nemusí ísť ani o veriacich) jednoducho nemôžu uveriť, že by „čosi také bolo možné“. R. Dawkins to nazýva Argument from Personal Incredulity (dôkaz z osobnej neschopnosti uveriť).

< ===== pokračovanie =====>

Verbálne myslenie odporcov evolučnej teórie ide až tak ďaleko, že si vymysleli „vedecké“ termíny „mikromutácie“ a „makromutácie“ a vyhlasujú, že tie prvé sú možné, ale tie druhé nie. Skúste sa ich však spýtať, čo znemožňuje genómu podstúpiť to, čo oni nazývajú makromutáciami, a nedozviete sa nič. Je to iba slovná clona na zatemnenie neznalosti. Tieto pojmy boli vymyslené len preto, aby sa dalo tvrdiť napríklad, že „Darwin pozoroval mikromutácie, a z toho vyvodil predpoklad, že rovnako fungujú i makromutácie; žiadne overenie, iba slepá viera v správnosť predpokladu“ (názor jedného čitateľa). Táto terminológia slúži len nato, aby sa dalo pripustiť, že domáce zvieratá sa síce menia, lebo to sa dá zaprieť asi tak úspešne ako nos medzi očami, ale aby sa mohlo odmietnuť to, čo z toho celkom jednoduchou extrapoláciou vyplýva: vznik všetkých druhov presne tým istým mechanizmom, aký pôsobí pri šľachtení.

< ===== pokračovanie =====>

„Boh nám predsa mohol podhodiť ,dôkazy‘ makroevolúcie ako skúšku našej viery.“

Kreacionisti používajú nielen všetky možné, ale dokonca aj celkom absurdné argumenty proti evolúcii, ako ilustruje v titule uvedený citát z „diela” Davida A. Plaisteda.

< ===== pokračovanie =====>

Nepochopenie štatistiky, nepochopenie základov fyziky

Po prvých úspechoch molekulárnej biológie preskupili kreacionisti svoje voje do vnútra buniek, na úroveň molekúl. Inými slovami, prešli od kritickej analýzy zmien fenotypu, k „reinterpretácii“ zmien na molekulárnej úrovni. Dlho som nechápal tento taktický manéver, pretože fenotyp je prejavom genotypu a keď si možno predstaviť postupné makroskopické zmeny, prečo by malo byť problémom prijať mikroskopické postupné zmeny genómu, teda molekuly DNA. Veď zmeny fenotypu sú prejavmi zmien genotypu a zo zmien fenotypu možno usudzovať na zmeny genómu. Teraz sa mi zdá, že tomu manévru už rozumiem: molekulárna biológia je menej názorná, procesy na molekulárnej úrovni vyzerajú oveľa komplikovanejšie než na úrovni makroskopického organizmu. Evolúcia molekuly predstavuje predsa len väčšie „mystérium“ než evolúcia makroorganizmu a ľahšie možno v tomto prípade hovoriť o stelesňovaní informácie.

Vysvetliť princíp spaľovacieho motora na fyzikálne makroskopickej úrovni dokáže aj človek so základným vzdelaním. Skúste však to isté vysvetľovať tak, že budete hovoriť o všetkých zúčastnených molekulách, nielen molekulách paliva, ale aj molekulách valca, piesta, elektrónoch v elektrickom výboji: zahrabete sa do spaľovacieho motora na celý život! Ale motor napriek nepochopeniu na molekulárnej úrovni funguje, molekuly sa správajú tak, že nám ich popis na vysvetlenie netreba. Prečo by sme potom mali motor analyzovať akurát na molekulárnej úrovni?

Tento pohľad mi pripomína jeden problém termodynamiky. Pre nikoho nie je problémom pochopiť, že ak nádobu, obsahujúcu plyn pod vysokým tlakom, spojíme (kovovou hadicou) s nádobou, v ktorej je vákuum, bude plyn do vákua prudko expandovať. Ale skúste to vysvetliť na mikroskopickej úrovni, ako dôsledok správania molekúl! Nepodarí sa vám to, pretože by ste museli vy osobne dokázať tzv. druhý zákon termodynamiky, vychádzajúc z mechaniky pohybu molekúl. A to po dnešné dni nie je s plnou exaktnosťou dokázané ani celou fyzikálnou pospolitosťou od prvej formulácie tohoto zákona Ludwigom Boltzmannom v r. 1872. Kľúčový problém s druhým zákonom spočíva v tom, že zákony riadiace pohyby molekúl sú vratné, zatiaľčo expanzia je proces nevratný. A zmyslom dôkazu tohoto zákona je odvodiť jednosmerné chovanie makroskopických sústav z obojsmerných mikroskopických zákonov. Druhý zákon teda na úrovni molekúl neplatí a to je hlavným pôvabom všetkých pokusov o jeho odvodenie.

V tejto súvislosti mi kreacionistický príklon k molekulárnej biológii pripadá ako pokus vyvrátiť druhý zákon termodynamiky argumentom, že molekulárne zákony sú vratné a preto z nich nemôže vyplynúť nevratné fyzikálne správanie. Pravda je však taká, že molekulárne zákony sú naozaj vratné, a napriek tomu z nich nutne vyplýva nevratné makroskopické správanie.

Na záver sa zmienim ešte o dvoch špekuláciách týkajúcich sa evolúcie. Ich autormi sú: britský filozof Sir Karl R. Popper a austrálsky neurofyziológ Sir John C. Eccles, nositeľ Nobelovej ceny za fyziológiu (1963), spoluautori monografie o vedomí The Self and Its Brain, Routledge, London 1995.

< ===== pokračovanie =====>

Pre úvahy o evolúcii dobre poslúži aj analýza vývoja jazykov. Iste netreba veľa námahy, aby ste medzi anglickým výrazom pre dcéru „daughter“, nemeckým „Tochter“, či gréckym „thygatér“ videli nápadnú podobnosť, rovnako ako medzi trojicou „mother“, „Mutter“ a „métér“. Ani jeden lingvista nemá ani len najmenšie námietky proti tvrdeniu, že súčasné germánske jazyky majú spoločného predka, rovnako ako jazyky románske, že germánske, románske aj slovanské majú opäť spoločného predka, jednoducho, že vývojový strom jazykov je nápadne podobný vývojovému stromu živočíšnych druhov.

Čo je na tejto analógii najpodstatnejšie? Nikoho ani vo sne nenapadne tvrdiť, že ktorýkoľvek z jazykov vznikol nezávisle od iných (kreacionistický postoj). Každý uznáva, že vznikli zmenami pôvodných jazykov, že majú spoločných predkov z ktorých divergovali: románske jazyky mali predka blízkeho latinčine, germánske nemčine, atď. (evolučný postoj). Vývojový strom jazykov je nápadne podobný stromu druhov. Z podobnosti slovnej zásoby, gramatickej a fonetickej štruktúry sa robia závery o spoločných predkoch.

Nikoho tiež netrápi pozoruhodná tendencia vo vývoji všetkých jazykov: čím ďalej do minulosti ideme, tým je aj gramatika aj hláskoslovie zložitejšie. Neustále sa zjednodušujúce jazyky museli teda vznikať z jazykov stále zložitejších. Adam musel zrejme hovoriť s Hospodinom aj s neborkou Evou jazykom, na ktorom by sme si my dnes dolámali jazyky (ak to len nebola hebrejčina). Nič nám samozrejme nebráni predstavovať si, že ten jazyk im dal sám boh a zvrhlé ľudstvo ho len postupne prznilo. Zaujímavé je len to, že ho znehodnocovalo (v princípe) rovnakým procesom mutácií, selekcie a dedenia, aký viedol k diverzifikácii druhov.

Prečo taký rozdiel v postojoch? Prijatím evolúcie v prípade jazykov nehrozí strata výnimočného postavenia, niet tu emocionálnej zábrany. Evolúcia jazykov sa uznáva napriek tomu, že odporuje biblickému mýtu o „zmätení“ jazykov, napriek tomu, že vývoj jazykov javí jednostrannú tendenciu ku gramatickému zjednodušovaniu, ktoré je kompenzované rastom syntaktickej zložitosti. Vysvetlenie je veľmi ľudské: averzia k vedeckému pohľadu na svet môže mať dva zdroje: pocit ohrozenia nášho výsadného postavenia poznatkami vedy a to, že odporuje biblickým mýtom. Ale pokrok sa nedá zastaviť. Kedysi neboli možné lietajúce neživé telesá, dnes aj kreacionisti lietajú na kongresy lietadlami. Kedysi bola Zem stredom Vesmíru, dnes nie je. Kedysi tu boli živočíšne a rastlinné druhy kvôli človeku, aby nad nimi vládol. Dnes už nie sú. Kedysi bolo jediným poslaním Vesmíru hrať divadlo pre človeka. A tejto poslednej ilúzie sa nedokážu kreacionisti zbaviť. Ale nebojte sa, zbavia sa!

http://adam.humanisti.sk/?p=48

 


spravodlivost
Share/Bookmark Subscribe pošli na vybrali.sme.sk TopČlánky.cz Facebook


V prípade, že chcete prispieť na chod dolezite.sk môžete tak učiniť zaslaním akéhokoľvek finančného príspevku na účet 420 208 3850 / 8360 mBank, variabilný symbol: 4444. Do účelu platby môžete uviesť Vaše meno, ktoré bude zverejnené s poďakovaním. Vyzbierané finančné prostriedky budú použité na skvalitňovanie a chod dolezite.sk. V prípade akýchkoľvek otázok ma neváhajte kontaktovať na dolezite zavináč dolezite.sk


Napíšte nám. Pošlite nám email s Vašim dotazom, návrhom alebo pripomienkou na adresu dolezite zavináč dolezite.sk
Myslíte si, že tento článok je dôležitý alebo zaujímavý? Pošlite ho cez e-mail alebo ho ukážte priateľom na Facebooku. Rozširujte informácie, nato sú predsa tu!




contedisavoya . simecymo35   |   ip:109.58.13   |   2011-09-28  (18:33)
50% hlasovalo = 0  
mínus plus
  Nic nove pod slnkom, clanok prevzaty zo stranky Adama Romana, udajne teoretickeho fyzika ktory sa na svoju ateisticku exhibiciu boji podpisat vlastnym menom. Ku evolucii len tolkoto:
1. S evoluciou ako takou nema uz vyse 100 rokov problemy ani Vatikan.
2. Evolucia je o vzniku novych druhov premenou organizmov, s tym ziaden seriozny vedec nema problemy
3. To co nam ostava uplne utajene je MECHANIZMUS akym premena druhov nastava. Nahodne mutacie DNA v genoch je rozpravka pre male deti a este k tomu pekne naivne. Matematicky sa da velmi lahko dokazat ze nahodna premena jednoho funkcneho organizmu na druhy je prakticky uplne vylucena.
4. darwinova teoria sa nezaobera abiogenezou, t.j. vznikom zivych foriem hmoty z nezivych, darwin totiz o mol. biologii nemal ani paru.
5.Millerov pokus dokazuje iba to ze v praatmosfere zeme mohli vznikat aminokyseliny, ale nic viac. Od chaotickej zmesi aminokyselin do zivota je este nepredstavitelne daleko.
6. Priklad: Pozname 23 esencialnych aminokyselin. Zive organizmy su zalozene na polypeptidoch-retazcoch aminokyselin, bieklovinach s katalytickou aktivitou-enzymoch. Zoberme do uvahy ze priemerny enzym obsahuje 100 aminokyselin.Funkcnost enzymu zavisi vzdy od sekvencie aminokyselin, jedina zamena spravidla sposobi stratu alebo zmenu funkcie enzymu. Pravdepodobnost spravneho ulozenia aminokyselin je teda1: 23^100 (23 na 100!!!) V dnes pozorovatelnom vesmire je 10^64 atomov (z toho 96% vodika, 3% helia a len 1% tazsich prvkov). Na zosyntetizovanie spravneho retazca 1 enzymu metodou pokus omyl by nestacili ani vsetky atomy viditelneho vesmiru.


contedisavoya . simecymo35   |   ip:109.58.13   |   2011-09-28  (18:38)
50% hlasovalo = 0  
mínus plus
  Evolucia je nieco ako elektricky naboj alebo gravitacia: Pozorujeme ju, mozeme ju kvantifikovast ale jej podstata nam ostava utajena. (Aj ked tu rozdiel je, posobenie gravitacie alebo el. naboja mozeme matematicky vyjadrit a predpovedat, u evolucie take cosi nie je mozne).
Ktosi raz povedal ze pravdepodobnost samovolneho vzniku zivota je asi taka ako keby sa po srotovisku prehnalo tornado a poskladalo by z odpadu boening.
Ja tvrdim ze je este ovela ovela nizsia.


prveterasista . xidegubi87   |   ip:95.154.23   |   2011-09-28  (18:57)
50% hlasovalo = 0  
mínus plus
  "Ktosi raz povedal ze pravdepodobnost samovolneho vzniku zivota je asi taka ako keby sa po srotovisku prehnalo tornado a poskladalo by z odpadu boening."

Tento povrchno-kostolný argument vypustil Behe,ale nie je to tak.
http://www.youtube.com/watch?v=CJ0NrlSMaTg



LordX . kyqabume9   |   ip:158.194.1   |   2011-09-28  (19:07)
50% hlasovalo = 0  
mínus plus
  Ku kreacionistickym vypoctom pravdepodobnosti abiogenezy:
http://www.talkorigins.org/faqs/abioprob/default.htm

"So let's play the creationist game and look at forming a peptide by random addition of amino acids. This certainly is not the way peptides formed on the early Earth, but it will be instructive.

I will use as an example the "self-replicating" peptide from the Ghadiri group mentioned above [7]. I could use other examples, such as the hexanucleotide self-replicator [10], the SunY self-replicator [24] or the RNA polymerase described by the Eckland group [12], but for historical continuity with creationist claims a small peptide is ideal. This peptide is 32 amino acids long with a sequence of RMKQLEEKVYELLSKVACLEYEVARLKKVGE and is an enzyme, a peptide ligase that makes a copy of itself from two 16 amino acid long subunits. It is also of a size and composition that is ideally suited to be formed by abiotic peptide synthesis. The fact that it is a self replicator is an added irony.

The probability of generating this in successive random trials is (1/20)32 or 1 chance in 4.29 x 1040. This is much, much more probable than the 1 in 2.04 x 10390 of the standard creationist "generating carboxypeptidase by chance" scenario, but still seems absurdly low.

However, there is another side to these probability estimates, and it hinges on the fact that most of us don't have a feeling for statistics. When someone tells us that some event has a one in a million chance of occuring, many of us expect that one million trials must be undergone before the said event turns up, but this is wrong.

Here is a experiment you can do yourself: take a coin, flip it four times, write down the results, and then do it again. How many times would you think you had to repeat this procedure (trial) before you get 4 heads in a row?

Now the probability of 4 heads in a row is is (1/2)4 or 1 chance in 16: do we have to do 16 trials to get 4 heads (HHHH)? No, in successive experiments I got 11, 10, 6, 16, 1, 5, and 3 trials before HHHH turned up. The figure 1 in 16 (or 1 in a million or 1 in 1040) gives the likelihood of an event in a given trial, but doesn't say where it will occur in a series. You can flip HHHH on your very first trial (I did). Even at 1 chance in 4.29 x 1040, a self-replicator could have turned up surprisingly early. But there is more.

1 chance in 4.29 x 1040 is still orgulously, gobsmackingly unlikely; it's hard to cope with this number. Even with the argument above (you could get it on your very first trial) most people would say "surely it would still take more time than the Earth existed to make this replicator by random methods". Not really; in the above examples we were examining sequential trials, as if there was only one protein/DNA/proto-replicator being assembled per trial. In fact there would be billions of simultaneous trials as the billions of building block molecules interacted in the oceans, or on the thousands of kilometers of shorelines that could provide catalytic surfaces or templates [2,15].

Let's go back to our example with the coins. Say it takes a minute to toss the coins 4 times; to generate HHHH would take on average 8 minutes. Now get 16 friends, each with a coin, to all flip the coin simultaneously 4 times; the average time to generate HHHH is now 1 minute. Now try to flip 6 heads in a row; this has a probability of (1/2)6 or 1 in 64. This would take half an hour on average, but go out and recruit 64 people, and you can flip it in a minute. If you want to flip a sequence with a chance of 1 in a billion, just recruit the population of China to flip coins for you, you will have that sequence in no time flat.

So, if on our prebiotic earth we have a billion peptides growing simultaneously, that reduces the time taken to generate our replicator significantly.

Okay, you are looking at that number again, 1 chance in 4.29 x 1040, that's a big number, and although a billion starting molecules is a lot of molecules, could we ever get enough molecules to randomly assemble our first replicator in under half a billion years?

Yes, one kilogram of the amino acid arginine has 2.85 x 1024 molecules in it (that's well over a billion billion); a tonne of arginine has 2.85 x 1027 molecules. If you took a semi-trailer load of each amino acid and dumped it into a medium size lake, you would have enough molecules to generate our particular replicator in a few tens of years, given that you can make 55 amino acid long proteins in 1 to 2 weeks [14,16].

So how does this shape up with the prebiotic Earth? On the early Earth it is likely that the ocean had a volume of 1 x 1024 litres. Given an amino acid concentration of 1 x 10-6 M (a moderately dilute soup, see Chyba and Sagan 1992 [23]), then there are roughly 1 x 1050 potential starting chains, so that a fair number of efficent peptide ligases (about 1 x 1031) could be produced in a under a year, let alone a million years. The synthesis of primitive self-replicators could happen relatively rapidly, even given a probability of 1 chance in 4.29 x 1040 (and remember, our replicator could be synthesized on the very first trial)."


FestinaLente . xexoxyje53   |   ip:193.200.1   |   2011-09-28  (19:08)
50% hlasovalo = 0  
mínus plus
  To je blbosť.
Boeing predsa vznikol náhodným zoskupovaním súčiastok, ktoré vznikli úderom blesku do prapolievky.
Tieto zoskupenia súčiastok potom prešli evolúciou a dnes tu máme Boeing.
Dôkazy na to sú:
Dr.Jožko Inštalatér Csc. videl letieť skrutku z ôsmeho poschodia dole - na zem.
Aj Boeingy majú skrutky a chýbajúcim medzičlánkom medzi skrutkou a Boeingom je padajúci traktor z ôsmeho poschodia.
Aj ked Dr.Filipko tvrdí, že existujú dôkazy, že existoval plávajúci traktor, ktorí vedci videli pri minuloročných záplavách.
Dr.Filipko vytvoril teoriu, že skrutky sa začali náhodne zoskupovať vo vode a až potom vyliezli an breh a začali lietať, ale teoriu popiera Dr.Zbytočný, ktorý odhalil slabinu v teorii vo forme existencie karburátora.
Nech je to ako chce, všetci vedci sa zhodujú na vedeckom vysvetlení vzniku Boeingu a odkazujú veriacim, že ich vysvetlenie o skonštruovaní Boeingu patrí do minulosti...



lucifer . faliqevu33   |   ip:78.141.69   |   2011-09-28  (19:10)
50% hlasovalo = 0  
mínus plus
  LordX..sorry...tu píšu Slováci...skús sa držať materinského jazyka:)


LordX . kyqabume9   |   ip:158.194.1   |   2011-09-28  (19:27)
50% hlasovalo = 0  
mínus plus
  Nesce sa mi to prepisovat :)

Nuz, v skratke je clanok o tom, ze pravdepodobnost nahodneho vzniku proteinoveho samoreplikatora je 1 ku 4.29 x 10 na 40, co sa laicky zda malo, ale ked si uvedomime ze tona argininu obsahuje 2,85 x 10 na 27 molekul, a zoberieme do uvahy experimentalne zistenu rychlost vznikania amk sekvencii pri vhodnych podmienkach (55 amk proteiny za 2 tyzdne), potom by niekolko ton z kazdej aminokyseliny v priemernom jazere sposobilo vznik takehoto replikatora za niekolko desiatok rokov, a v objeme prehistorickeho oceanu by to trvalo menej ako rok.
To vsetko je len pravdepodobnost vzniku jedneho konkretneho proteinoveho samoreplikatora, ale tych je samozrejme ovela viac.


contedisavoya . simecymo35   |   ip:109.58.13   |   2011-09-28  (19:51)
50% hlasovalo = 0  
mínus plus
  Lord X
Ha! Lenze na to aby si ziskal peptid potrebujes NK. Na to aby si ziskal NK potrebujes peptid- presne povedane enzym NK ligazu. To ze v labaku ktori vytvori replikator dokazuje len to ze CLOVEK (t.j. inteligentna bytost) dokaze napodobit deje v prirode, nic viac. Ten prilkad co uvdzas je stary a otrepany, nicn ove. samovolny vznik chaotickych peptidov studovali japonci v 70tych rokoch (meno autorov som zabudol mozem zistit) ale dosli len ku rovnovaznej zmesi kde prave tolko peptidovych väzieb vznikalo kolko zanikalo.
Ku zivej bunke je od 32- clenneho polypeptidu este na eony daleko...


FestinaLente . xexoxyje53   |   ip:193.200.1   |   2011-09-28  (20:19)
50% hlasovalo = 0  
mínus plus
  Daľší článok od humanistov, teda slobodomurárov.
Pokiaľ ale viem, oni tiež uctievajú Veľkého Staviteľa...
Nie?
http://www.humanizmus.sk/


Groover . kyrovuse69   |   ip:217.119.1   |   2011-09-28  (20:21)
50% hlasovalo = 0  
mínus plus
  Je to ako vyhrať za sebou 14x v lote.

To je absurdita ich tvrdení o predstave sveta. ;)


lenlen . lovegigu11   |   ip:85.239.25   |   2011-09-28  (20:54)
50% hlasovalo = 0  
mínus plus
  ludia prisli z inej planety

Všetko biele obyvateľovo našej Zeme sa nazýva RASA, čo znamená biely, čistý, svetlý, prvopočiatočný. Odtiaľto pochádza aj rímsky výraz „Tabula rasa“. Ako v podstate všetky prastaré, prvopočiatočné slová ide o skratku: Rody Asov Strany Asov – čo zo staroslovienskeho ale aj dnešného ruského jazyka prekladáme ako „Rody Asov krajiny Asov“. Aj keď o tomto budeme písať neskôr, povedzme si, že „As“ alebo „Az“ je Svetlý Boh žijúci na Zemi, domovina Asov je preto Ázia alebo „Asia“. V skratke môžeme vysvetliť, že sa nejedná automaticky len o bieleho človeka. Tento musí mať aktivovaný energetický systém všetkých deviatich čakier a otvorených všetkých 16 kanálov vnímania sveta, inak nemá spojenie s Vyššími energiami – Svetlými Bohmi. V ponímaní Véd a prvopočiatočnom význame slova nemajú teda výrazy ako „žltá rasa“, “čierna rasa“, „červená rasa“ nijaký význam. Budeme ich však používať z toho dôvodu, aby bol text pochopiteľný dnešnému človeku.
Predstavitelia národov Rasy ako prví kolonizovali Zem. Pred asi 1 miliardou rokov prileteli z iných Zemí (= planét – slovo pôvodne tiež úplne iného významu ako dnes), ktoré sa nachádzajú v súhvezdiach Malej a Veľkej Medvedice, Leva a Kassiopei. Navzájom sa líšili iba farbou dúhovky očí, ktorá závisí od spektra svetla sĺnk ich rodných planét: strieborná – Da-Árijci, zelená – Ch-Árijci, modrá – Svätorusi, ohnivá (hnedá) Rasséni (Rasiči). Svätorusi a Rasséni sú Slovania, ostatní Árijci.

http://vedy.sk/sk/vznik_vesmiru.php#vznik_zivota


lenlen . lovegigu11   |   ip:85.239.25   |   2011-09-28  (20:59)
50% hlasovalo = 0  
mínus plus
  to co krestania veria ze ich spravil boh z hliny
ano su tu take bytosti
slovania ich volaju TVAR

su skoro ako ludia
lenze nemaju svedomie , tzv bioroboti

http://vedy.sk/sk/hladanie_pravdy.php#tvari

vytvoril ich parazit jahve ako svojich sluhov , otrokov
vola ich ze ovecky


lucifer . faliqevu33   |   ip:78.141.69   |   2011-09-28  (21:02)
50% hlasovalo = 0  
mínus plus
  lenlen...to čo tvrdíš nedáva logiku...pretože by neexistoval stredovek.


lenlen . lovegigu11   |   ip:85.239.25   |   2011-09-28  (21:05)
50% hlasovalo = 0  
mínus plus
  lucifer skus to trosku ozrejmit

to co sa dnes uci je historia
hisTORIa
nie dejiny , ale hisTORIa
:)

vsetko pisali ti co boli pri moci
cize zidokrestanska mafia





alfo . resabevu49   |   ip:85.216.16   |   2011-09-28  (21:21)
50% hlasovalo = 0  
mínus plus
  a co tak panspermia. nad tym sa iba malo ludi zamysla pri tychto skriepkach ohladom evolucie....


Petr . jedyvihy65   |   ip:78.45.16.   |   2011-09-29  (02:41)
50% hlasovalo = 0  
mínus plus
  Evoluce se zadrhla u lidi - treba u tech hovad v Mexiku:

http://pravdu.cz/poprava/poprava-motorovou-pilou-loveckym-nozem



illuminatedBimbo . wavapihi67   |   ip:95.103.15   |   2011-10-02  (12:56)
50% hlasovalo = 0  
mínus plus
  Evolúcia existuje! Uvediem príklad:
Ateista ktorý súhlasí s "úrokom" alebo sa nejakou formou v živote podujme platiť úroky ,týmto vlastne súhlasí s niečim čo vlastne realne nikto do obehu nedal a teda to naozaj realne neexistuje.Týmto vlastne toto uctieva podobne ako náboženstvá.


lucifer . faliqevu33   |   ip:78.141.69   |   2011-10-02  (13:10)
50% hlasovalo = 0  
mínus plus
  Evolúcia NEEXISTUJE...uvediem príklad...má snáď iný živočích ľudské DNA?...mimochodom ak by ste chceli potvrdiť pravosť evolúcie...museli by ste nájsť kosti z opičou podobou ktorá bude niesť ľudské DNA...našli sa už také?...nenašli?...ani nenájdu, lebo ani neexistujú...uverili ste pár vedcom, ktorý týmto klamstvom vošli do histórie a krásne si žili ako slávni ľudia...začnite byť konečne sami sebou...neustále len niekoho napodobňujete...viete vlastne kto ste vy samotný?


lucifer . faliqevu33   |   ip:78.141.69   |   2011-10-02  (13:14)
50% hlasovalo = 0  
mínus plus
  lenlen...bez urážky...ale neprotirečíš si náhodou?...nepozeraj furt do toho googlu...ale ak si chceš overiť pravosť informácii na nete...navštív aj knižnice, kde to v knihách určite nenájdeš že tieto klamstvá napísal židokresťan...to fakt veríš všetkému čo si vygoogliš?...nemýliš sa?


Pandemonium . darujete36   |   ip:188.123.1   |   2011-10-02  (13:26)
50% hlasovalo = 0  
mínus plus
  Človek by skoro aj uveril, že sa sviečkovým tupcom evolúcia vyhla veľkým oblúkom a ponechala im len nervový uzlík, ako modlivke. To im bohate stačí na to, aby vedeli spínať predné paprčky a klaňať sa jednej modle.


FestinaLente . xexoxyje53   |   ip:193.200.1   |   2011-10-02  (13:30)
50% hlasovalo = 0  
mínus plus
  illuminatedBimbo:
To je veľmi zaujímavý pohľad...
Navyše sa finančníctvo aj študuje a vysvätení kňazi tohto nového náboženstva sa klaňajú zlatým teliatkam.
Vyvolávajú náboženské vojny a vedome udržujú masy veriacich v nevedomosti.
Sväté obrázky má každý v šrajtofli a čím ich má viac, tým je viac veriaci.



kucma . fyvafixa2   |   ip:87.244.22   |   2011-10-02  (14:38)
50% hlasovalo = 0  
mínus plus
  okej, evolucia neexistuje.
vsetky zvierata tu nasadil boh. no a potom sa VSETKY! suchozemske zvierata zviezli na noemovej arche a po vylodení sa znova rozmnozovali a rozsirili do vsetkych koncin sveta, ba preplavali aj na ine kontinenty...
hahahahahahaha...
pukaju mi rebra od smiechu...


kucma . fyvafixa2   |   ip:87.244.22   |   2011-10-02  (14:58)
50% hlasovalo = 0  
mínus plus
  http://sk.wikipedia.org/wiki/Noemova_archa

kua, toto je dobre. Dr. Doolitle - Dr. Noe im poslal mail, aby sa vsetky zvierata z celeho sveta dostavili na jeho lod, bo pride potopa...
a potom sa poslusne vratili odkial prisli.
som rad, ze vybral len tie najmudresjie zvierata, pretoze tie s kuskom pudov by sa boli pozrali, tak ako to robia dodnes.
hahahahahahaha.
uz dost, to boli...


kucma . fyvafixa2   |   ip:87.244.22   |   2011-10-02  (15:23)
50% hlasovalo = 0  
mínus plus
  http://sk.wikipedia.org/wiki/Babylonsk%C3%A1_ve%C5%BEa_%28Babylon%29

dalsia perlicka. jazyky sa vraj rozdelili padom babylonskej veze. bohu sa nepacilo, ze sa chcu dostat do neba... je jasne ze mysleli to modre nahore...
ja sikam!
ved este aj v dnesnej dobe takmer denne vzikaju a zanikaju jazyky.
teisti, ak chcete napadat ateisticke nazory, poprosim o lepsie teorie. az potom sa budu ateisti moct s vami bavit na cloveka hodnej urovni.
zatial sa mozete ist pásť...



lucifer . xivykige56   |   ip:78.141.69   |   2011-10-02  (16:23)
50% hlasovalo = 0  
mínus plus
  kucma...ale oni nestavali babylónsku vežu pre BOHA, ale pre mňa...lucifera...preto ju BOH rozbil a rozprášil Národy a každému z nich dal iný jazyk...pozri teraz...NWO máš len ďalší pokus o babylónsku vežu...jeden jazyk...jeden vládca....a kucma...zvieratá sa rozšírili presne ako ľudia...to je také ťažké pochopiť?


kucma . fyvafixa2   |   ip:87.244.22   |   2011-10-02  (16:25)
50% hlasovalo = 0  
mínus plus
  no zda sa ze to je tazke pochopit.
ako sa ten tvor s dusou mohol rozsirit tak ako tie tvory bez duse?


lucifer . xivykige56   |   ip:78.141.69   |   2011-10-02  (16:28)
50% hlasovalo = 0  
mínus plus
  ...zase urážky?...maj sa.


kucma . fyvafixa2   |   ip:87.244.22   |   2011-10-02  (16:31)
50% hlasovalo = 0  
mínus plus
  tak tak.
zvierata sa rozsirili presne tak ako ludia.
sam si mi to potvrdil.
no prosim, neurazaj sa, aj ked nechapem cim?


lucifer . faliqevu33   |   ip:78.141.69   |   2011-10-02  (16:34)
50% hlasovalo = 0  
mínus plus
  ...ale ja sa neurážam...kde si nato prišiel?...len sa my nechce s tebou diskutovať ak budeš len urážať.


kucma . fyvafixa2   |   ip:87.244.22   |   2011-10-02  (16:44)
50% hlasovalo = 0  
mínus plus
  aha.
ja len ze si to tak napisal.
no a chces aj diskutovat, ci sa chces len urazat?


lucifer . faliqevu33   |   ip:78.141.69   |   2011-10-02  (16:44)
50% hlasovalo = 0  
mínus plus
  kucmááááááááááá...kde si?


lucifer . faliqevu33   |   ip:78.141.69   |   2011-10-02  (16:45)
50% hlasovalo = 0  
mínus plus
  ..o.k....tu si...takže to bolo tak...všetko zverstvo aj ľudia sa rozšírili po planéte rovnako....párením.


lucifer . faliqevu33   |   ip:78.141.69   |   2011-10-02  (16:46)
50% hlasovalo = 0  
mínus plus
  .. prepáč ak sme sa nepochopili...ale nechce sa my viesť dialóg s niekym ako je pandemonium.


kucma . fyvafixa2   |   ip:87.244.22   |   2011-10-02  (16:49)
50% hlasovalo = 0  
mínus plus
  no a co cakas, ze ti to vyvratim abo co?
sak jasne, tvoj otec mal otca, otec tvojho otca mal otca a tak to ide az k pocitakom zivota na tejto planete. takze v podstate je jednobunkovy organizmus tvojou aj mojou rodinou.
nic take ako zasadenie zivota na tuto planetu v takej forme ako je teraz nemozem povazovat za logicku teoriu.
a uz vobec nie, ze sa vsetky druhy zmestili na nejaku archu a potom sa dokazali napat rozsirit.


lucifer . faliqevu33   |   ip:78.141.69   |   2011-10-02  (16:53)
50% hlasovalo = 0  
mínus plus
  ...kucma...ale niekde musel začať prvý pár ľudí...či nie?...takže sme rodina či sa ti to páči alebo nie:)


lucifer . faliqevu33   |   ip:78.141.69   |   2011-10-02  (16:53)
50% hlasovalo = 0  
mínus plus
  ...čo myslíš máme predkov v zoo?


lucifer . faliqevu33   |   ip:78.141.69   |   2011-10-02  (16:55)
50% hlasovalo = 0  
mínus plus
  ...nepôjdeme ich navštíviť?...ale to len srandujem...neboj nebudem si nárokovať na tvoj majetok ako dedičstvo:)


kucma . fyvafixa2   |   ip:87.244.22   |   2011-10-02  (16:58)
50% hlasovalo = 0  
mínus plus
  tesi ma ze sme sa pochopili.
no nemyslim si, ze si to ludia len tak zo dna na den uvedomili, ze oddnes sme ludia.
samozrejme sa vyvinuli.
jeden dokaz o evolucii. zajdi si niekedy na hocijaky hrad.tam uvidis, ze stredoveki ludia boli krpati a ovela viac zarasteni.
dalsi dokaz. podla teba by vsetci ludia vyzerali rovnako. samozrejme ze evolucia sa riadi variaciami, a priroda to zariadila tak, ze nie kazda mutacia je schopna prezit - vola sa to zakon silnejsieho.
ozaj akej farby je boh? ak je clovek stvoreny na jeho obraz...


kucma . fyvafixa2   |   ip:87.244.22   |   2011-10-02  (17:00)
50% hlasovalo = 0  
mínus plus
  ale ty srandista.
jasne ze v zoo nemame predkov. nasi predkovia su uz davno vyhynuti. do zoo zatvarame len menejcenne formy zivota, vies tie bez duse


lucifer . faliqevu33   |   ip:78.141.69   |   2011-10-02  (17:03)
50% hlasovalo = 0  
mínus plus
  BOH a JEŽÍŠ sú bieli...ale hlavne sú živý tak ako ti...mimochodom prečo si myslíš že v stredoveku boli ľudia krátkeho vzrastu a zarastený?...a ak narážaš na farbu pleti...tak to je jednoducho prispôsobením sa k podnebiu.


lucifer . faliqevu33   |   ip:78.141.69   |   2011-10-02  (17:04)
50% hlasovalo = 0  
mínus plus
  ...ale zvieratá majú dušu...a ak umrú idú jednoducho do NEBA...prebývajú tam spolu s ľudmi...u BOHA nič neumiera...a správajú sa rovnako ako tu na ZEMI.


ANONYM . sipyrige36   |   ip:195.168.1   |   2011-10-02  (17:05)
50% hlasovalo = 0  
mínus plus
  ci ze ludia sa rozmnozili z prveho paru ? ved potom sa museli medzi sebou parit pribuzny rovno pod dohladom boha a jemu to nevadilo.nechapem preco potom cirkev zakazuje parenie pribuznych,zebi bola mudrejsia ako boh,haha


kucma . fyvafixa2   |   ip:87.244.22   |   2011-10-02  (17:06)
50% hlasovalo = 0  
mínus plus
  no bol som minuly tyzden na spisskom hrade.
PRISPOSOBENIM SA?
take ruhanie z tvojej strany som teda necakal. aky dokaz o evolucii este potrebujes?
no nic, nehnevaj sa, ale ide hokej. ten ma teraz zaujima viac ako tvoje zvlastne myslienkove pochody...
maj sa



lucifer . faliqevu33   |   ip:78.141.69   |   2011-10-02  (17:14)
50% hlasovalo = 0  
mínus plus
  kucma...ale ľudia doteraz nemajú rovnakú výšku...či majú?...ANONYM...a tak sme sa rozšírili až doteraz...jednoducho to tak je...a tvoja evolúcia to nezmení...ozaj...niekde musel byť prvý ľudský pár...či nie?...alebo si myslíš že sme prileteli a vrátili sa dobrovoľne späť do stredoveku?


ANONYM . sipyrige36   |   ip:195.168.1   |   2011-10-02  (17:22)
50% hlasovalo = 0  
mínus plus
  precitaj si znovu co som napisal a precitaj si aj svoju odpoved a porozmislaj.mimochodom mislis ze bol aj prvi par krav ,ktori sa potom rozmnozil?


lucifer . faliqevu33   |   ip:78.141.69   |   2011-10-02  (17:33)
50% hlasovalo = 0  
mínus plus
  ANONYM...ale ja viem načo narážaš...áno všetci sme príbuzný, koniec koncov nosíme v sebe rovnaké DNA či nie?...samozrejme že kravičky sa rozmnožili tiež z prvého páru.


kucma . fyvafixa2   |   ip:87.244.22   |   2011-10-02  (18:42)
50% hlasovalo = 0  
mínus plus
  lucifer.
tvoj problem je, ze aj ked ti prisposobovanie sa okolitemu prostrediu dava zmysel, tak ako si to napisal, tvoja absolutisticka viera ti nedovoluje coilen o tom rozmyslat.
a to je zle.
stale tu napadas DNA, no si to ty, co sa tu ohana noemovou archou, takze tahas za kratsi koniec.
ludia ani teraz nemaju rovnaku vysku, koniec koncov som pisal o variaciach. no ked budes na tom hrade, nezlakni sa, nie si na prvom stupni zakladnej skoly.



lucifer . faliqevu33   |   ip:78.141.69   |   2011-10-02  (18:54)
50% hlasovalo = 0  
mínus plus
  ...viete čo je vašim problémom ľudia, že dokážete z jednoduchej PRAVDY...urobiť komplikovanú politiku...prečo?...aby sa náhodou nestalo že budete posledný v rade?...kucma, celú históriu ľudstva máš vysvetlenú v starom zákone a v novom zákone...ak mali šľachtici a rytieri 150 cm..ešte neznamená že boli najvyšší ľudia v okolí...alebo sa mýlim?


lucifer . faliqevu33   |   ip:78.141.69   |   2011-10-02  (18:56)
50% hlasovalo = 0  
mínus plus
  ...DNA je stále rovnaké...aké mal Adam s Evou také máme presne my....terajší ľudia...BOH nič na nás nezmenil...sme rovnaký ako na počiatku tak budeme aj na konci.


rafael . qelyhutu11   |   ip:188.167.7   |   2011-10-02  (19:40)
50% hlasovalo = 0  
mínus plus
  Najviac ma zaujala ta navigacia zvierat po opadnuti vod, aby sa na urcite uzemie dostali len urcite druhy zvierat. Uz to je dokazom vole bozej, ze sa napr. do Europy nenastahovali klokani, alebo ladove medvede na Juzny pol.


lucifer . faliqevu33   |   ip:78.141.69   |   2011-10-02  (19:49)
50% hlasovalo = 0  
mínus plus
  Rafael...si to ti?...dobre čítam?


rafael . qelyhutu11   |   ip:188.167.7   |   2011-10-02  (19:50)
50% hlasovalo = 0  
mínus plus
  Pochopenie sarkazmu nie je tvoja silna stranka, ale som to ja.


lucifer . faliqevu33   |   ip:78.141.69   |   2011-10-02  (19:58)
50% hlasovalo = 0  
mínus plus
  ...sarkazmus?...prepáč tešil som sa že si UVERIL...ale odhadol si to presne každé zviera je presne tam kde ho BOH chce mať a kde sa mu darí najlepšie.


rafael . qelyhutu11   |   ip:188.167.7   |   2011-10-02  (20:04)
50% hlasovalo = 0  
mínus plus
  To mas pravdu presne si trafil, ak samozrejme boh je znakom pre prirodzeny vyber....Ale samozrejme, ze tvoja definicia je znacne skreslena tym, ze veris pitomostiam, co ti brani poznaniu, preco tomu skutocne tak je. Lebo levom by sa rovnako dobre darilo aj v Australii, ci klokanom v Juznej Amerike.


lucifer . faliqevu33   |   ip:78.141.69   |   2011-10-02  (20:15)
50% hlasovalo = 0  
mínus plus
  ...ako vieš?


lucifer . faliqevu33   |   ip:78.141.69   |   2011-10-02  (20:17)
50% hlasovalo = 0  
mínus plus
  ...nie je pre nich miesto tam kde sú...prirodzeným prostredím...majú tam všetko to čo potrebujú či nie?


Groover . kyrovuse69   |   ip:217.119.1   |   2011-10-02  (20:19)
50% hlasovalo = 0  
mínus plus
  //take ruhanie z tvojej strany som teda necakal. aky dokaz o evolucii este potrebujes?
no nic, nehnevaj sa, ale ide hokej. ten ma teraz zaujima viac ako tvoje zvlastne myslienkove pochody...//

Televízna manipulácia..

Treba spievať maha mantru

Hare Krishna Hare Krishna Krishna Krishna Hare Hare
Hare Rama Hare Rama Rama Rama Hare Hare



kucma . fyvafixa2   |   ip:87.244.22   |   2011-10-02  (20:53)
50% hlasovalo = 0  
mínus plus
  lucifer.

na vdzory vsetkym pochybnostiam, prosim ta, este mi zisti z tej mudrej knihy, ako sa vsteky druhy zivocichov vobec do takej archy zmestili a este v paroch.

este raz parametre
http://sk.wikipedia.org/wiki/Noemova_archa

toto ani ty nemozes mysliet vazne...


kucma . fyvafixa2   |   ip:87.244.22   |   2011-10-02  (20:58)
50% hlasovalo = 0  
mínus plus
  groover.
teba hovno po tom co ja robim vo svojom volnom case.
nezaujimaju ma ani tvoje védy ani tvoja mantra.
a nekopiruj moje slova.
zbohom


lucifer . faliqevu33   |   ip:78.141.69   |   2011-10-02  (21:10)
50% hlasovalo = 0  
mínus plus
  ...myslím:)...vysvetli my prečo by to malo byť nemožné?


kucma . fyvafixa2   |   ip:87.244.22   |   2011-10-02  (21:15)
50% hlasovalo = 0  
mínus plus
  aha. tak ty si zo mna robis vazne srandu.
no nic. mozno tam mal len DNA vsetkych zvierat...
utekaj za fararom nech rychlo prepisuje bibliu.


lucifer . faliqevu33   |   ip:78.141.69   |   2011-10-02  (21:17)
50% hlasovalo = 0  
mínus plus
  ...až keď my vysvetlíš prečo by to nemalo byť možné...potom za nim pôjdem sľubujem.


lucifer . faliqevu33   |   ip:78.141.69   |   2011-10-02  (21:27)
50% hlasovalo = 0  
mínus plus
  ..žeby si my nevedel vysvetliť prečo je to nemožné?...a kde potom berieš tu istotu?


kucma . fyvafixa2   |   ip:87.244.22   |   2011-10-02  (21:29)
50% hlasovalo = 0  
mínus plus
  VSETKY?
150 × 25 m su zhruba 3 plavecke bazeny.
to je teda sila. tvoja viera je velmi silna...


lucifer . faliqevu33   |   ip:78.141.69   |   2011-10-02  (21:40)
50% hlasovalo = 0  
mínus plus
  ..plus 15 metrov do výšky...vyrátaj štvorcové metre a vsuň do nich zvieratá...aj tie čo majú výšku a šírku ako krtkovia.


kucma . fyvafixa2   |   ip:87.244.22   |   2011-10-02  (21:50)
50% hlasovalo = 0  
mínus plus
  http://adam.cas.sk/clanky/10765/na-zemi-zije-asi-8-7-miliona-druhov-90-z-nich-vobec-nepozname.html

nikdy som nebol dobry v matematike. dajme tomu, ze ratas s 3 poschodiami.

11250 m2/8 700 000= 0,0013 m2
vela stastia.



kucma . fyvafixa2   |   ip:87.244.22   |   2011-10-02  (21:53)
50% hlasovalo = 0  
mínus plus
  jaj prepac.
to som zabudol, ze su v paroch. este to vydel 2.


Ip . sykygage89   |   ip:188.112.1   |   2011-10-02  (22:13)
50% hlasovalo = 0  
mínus plus
  kucma:
matematika Ti fakt nejde. Mne to vyšlo 6 litrov priestoru na jeden druh a to som neodrátal tých 2,2 miliona druhov ktéré sú v mori a teda nemuseli byť v arche. Ďalší zaujímavý údaj by bol koľko milionov druhov je menších rozmerov ako 10 cm.


kucma . fyvafixa2   |   ip:87.244.22   |   2011-10-02  (22:22)
50% hlasovalo = 0  
mínus plus
  lucius.
no nic ty teda vies vyuzivat priestor. takze este raz.
ratajme aj s odchylkou.
7,8 - 2,2 - 1,3 odchylka = 4,3 x 2 pary = 8,6 miliona zivocichov.
56 250/ 8 600 000 je 6 litrov. dufam ze je to tak teraz spravne.
gratulujem. to si ale vyuzil kompletny priestor bez medzier.
myslim ze mam dost. som rad ze mu na tu archu vsetky druhy prisli, inac by to bola katastrofa...
dobru noc a snivaj dalej...


kucma . fyvafixa2   |   ip:87.244.22   |   2011-10-02  (22:23)
50% hlasovalo = 0  
mínus plus
  vlastne to patrilo lp


rafael . qelyhutu11   |   ip:188.167.7   |   2011-10-03  (11:46)
50% hlasovalo = 0  
mínus plus
  Ip, a vies, ze su vodne zivocichy, ktore more neznesu? Tak do toho prosim pekne zarataj miliony druhov sladkovodnych zivocichov samozrejme kazde v nejakom akvariu, a uz to ti zaisti preplnenu lodicku zvana Noemova archa, lebo ako vieme, aj tie potrebuju vodu, potrebuju dostatok priestoru, nehovoriac o srandovnom logistickom usporiadani suchozemskych zvierat bez moznosti pohybu. Dalej si samozrejme vo svojich vypoctoch nedoplnil miesto na potravu. Garantujem ti, ze ak by si do tej lodicky vtesnal len zvierata z jednej ZOO, mal by si plno.


Ip . sykygage89   |   ip:188.112.9   |   2011-10-03  (19:54)
50% hlasovalo = 0  
mínus plus
  Rafael:
Problém je, že je ťažko dopátrať sa k objektývnym informáciam, takže bolo by čestné povedať, že nevieme ako to bolo.
Prvý problém je samotná miera lakeť, koľko to bolo presne v tej dobe? V jednej knihe o potope som sa dočítal, že existujú rôzne mierky pre lakeť od 40 cm do 114,3 cm. Koľko cm mal presne lakeť noemovej archy, nevieme.
Druhý problém je samotný počet živočíchov, vieme presne koľko ich je, alebo bolo v tej dobe? Tu hore sme sa bavili o 8 700 000 živočichov, ale na stránke: http://server.sk/zaujimavosti/priroda/na-zemi-zije-8-7-miliona-druhov-rastlin-a-zivocich/
sa tých 8 700 000 vsťahuje na živočíchy rastliny, huby a prvoky, nie su do toho zarátane baktérie.
Pri tom je to podľa mňa veľmi hypotetický odhad, keďže popísaných zatiaľ bolo len asi 1,2 miliona rastlín a živočíchov. Predpokladám že čo sa týka nepopísaných živočíchov ide asi o živočíchy nie veľkých rozmerov.
Čo sa týka toho čo píšeš ohľadom slanosti vody tak moria pred Tisícročiami určite neboli rovnako slané ako dnes a vody potopy vôbec nemuseli byť slané.
Ľudským odhadom veľmi neverím sú nespoľahlivé. Ak si to chceš overiť skús odhadnúť akú hrúbku (skôr ako to skúsiš počítať) bude mať papier ak má jeden list papieru hrúbku 0,1 mm ak ho preložíš 1x budeš mať 2 vrstvy papieru o hrúbke 2 mm keť to znovu preložíš získaš 4 vrstvy papieru o hrúbke 0,4 mm. Otázka je aká bude celková hrúbka papieru ak ho prehneš 40x
Zvierátá z jednej Zoo v korábe by boli v pohodičke aj s kopou voľného priestoru aj ak by lakeť bol len 40 cm


trtko . fumisima35   |   ip:85.237.22   |   2011-10-03  (21:07)
50% hlasovalo = 0  
mínus plus
  Lenlen - vedy.sk rád čítam ale tabula rasa znamená nepopisaní papier


lucifer . faliqevu33   |   ip:78.141.69   |   2011-10-03  (21:31)
50% hlasovalo = 0  
mínus plus
  ...ale Noemova ercha bola objavená..presne sedia aj rozmera podľa BIBLIE..takisto sa objavili mestá sodoma a gomora..mestá pokryté popolom a sírou...ateisti zbytočne tu budete popierať fakta...BOH a JEŽÍŠ EXISTUJÚ A SÚ ŽIVÝ...tak ako vy...nikto Vás nenúti aby ste uverili ateisti...ale uvedomte si jednu vec...že ste to práve VY, ktorý tak pohŕdajú...a urážajú všetko Kresťanské...prečo?...napáda Vás niekto na ulici?...berie Vám zárobok?...nárokuje si na Vaše životy, alebo slobodu?...poviem Vám na rovinu...som človek 21.stor....či sa Vám to páči alebo nie...preferujete sa tu poniektorý ako všeobecne znalý, inteligentný a múdry ľudia...ale múdry človek...neodsudzuje druhého za jeho VIERU...skôr sa zaújma a báda...ale vy len popierate a prekrúcate...nemáte žiadne znalosti..len tie čo si nájdete v googly...vlastne to je Vaša modla.


kucma . fyvafixa2   |   ip:87.244.22   |   2011-10-03  (23:23)
50% hlasovalo = 0  
mínus plus
  lucifer.
co to zase trepes? clovek neodsudzuje druheho cloveka za jeho VIERU? ty si tu ten POKRYTEC, co odsudzuje VSETKY OSTATNE VIERY. uz som ti hadam vysvetlil, ze si taky isty ateista ako ja. no az na jedineho boha.
este sa ta spytam tak isto, preco je pre teba a tebe podobnym tak dolezite, aby ateisti uverili vo vsetko KRESTANSKE. ved nikoho nenapadame na ulici, neberieme nikomu zarobok, nenarokujeme si na ziadne zivoty ani slobodu. my sme ludia 21 storocia.
lp
zase sme skoncili, tak ako vzdy a so vsetkym s tvojou vierou suvisiacim, ze co ked ma laket, a ak prehnes papier 40x... kua, sak otvor tu svoju superknizku a daj konecne presne rozmery, nech mozeme bavit na racionalnej baze.

spajat noemovu archu s dnesnym rozmanitym svetom zivocisnej rise je NAJSPOSTEJSIE NAPADNUTIE ROZUMU S AKYM SOM SA DOTERAZ STRETOL.



kucma . fyvafixa2   |   ip:87.244.22   |   2011-10-03  (23:39)
50% hlasovalo = 0  
mínus plus
  LEN HLUPAK SA MOZE STOTOZNIT S TAK HLUPYMI TEORIAMI.
k tomu ani nie je viac co dodat. vy veriaci vykvet spolocnosti...

"Najvacsia hlupost je diskutovat o hluposti s hlupymi" :Aristotelés


Ip . bysoniwy6   |   ip:188.112.8   |   2011-10-04  (09:03)
50% hlasovalo = 0  
mínus plus
  kucma
problém je s tým naším odhadovaním, skúsil si odhadnúť tu hrúbku toho papiera. Schválne napíš nejaké číslo. Rafael z tým odhadom zvierat zo Zoo prestrelil archa aj tých najmenších rozmerov by bola poloprázdna ak počítám, že napríklad v Pražskej Zoo je len niečo cez šesto druhov zvierat asi 4000 jedincov.
Rovnako je prehnaný ten počet druhov s ktorými sme začínali rátať. Presné informácie nemáme. V literatúre som sa stretol z jedným pokusom naplniť Noemovú archu. Tú knihu už asi nedostaneš ale rátalo sa tam z 18 600 zvieratmi 24 400 kusov vtákov 12000 kusov hadov 2 000 000 hmyzu a samozrejme 8 ľuďmi. Vo vypočte bol zahrnutý osobný objem zvierat, priestor na pohyb objem klietok a objem na potraviny. Napríklad objem na potraviny tam bol vypočítaný na 17 129 metrov kubických. Bez zaujímavosti nie je že priemerná veľkosť zvieraťa je asi veľkosť mačky.


kucma . fyvafixa2   |   ip:87.244.22   |   2011-10-04  (10:23)
50% hlasovalo = 0  
mínus plus
  IP.
moju odpoved uz mas vyssie.

ak tomu veris je to len TVOJ PROBLEM.
pre mna za mna si za tuto teoriu o rozmanitosti zivocisnej rise narokuj na NOBELOVU CENU ZA BIOLOGIU.
mne je to totiz uplne jedno. chapes?

je to len BOHAPUSTY NEZMYSEL !!! aby sa vsetky zivocichy dokazali intuitivne dostavit na nezname miesto. a akurat jeden z par z kazdeho druhu. nato aby si boh dal taku namahu ked je vsemohuci by bolo ovela logickejsie aby odvratil potopu, nez zmiatol zo sveta vsetko zive.

VSETKO ZIVE !!! CHAPES? NEZABIJES !!! CHAPES?
ci ako ti to mam este vysvetlit?




kucma . fyvafixa2   |   ip:87.244.22   |   2011-10-04  (10:33)
50% hlasovalo = 0  
mínus plus
  p.s.
http://ireferaty.lidovky.cz/2/2969/Gilgames



lucifer . faliqevu33   |   ip:78.141.69   |   2011-10-04  (13:39)
50% hlasovalo = 0  
mínus plus
  ...tééééda...kucma...že ti nieje hanba...takto ma obviniť s napádania na iných...doteraz som tu nikoho ani neurazil...a rešpektovať iné viery nemám prečo...lebo BOH a JEŽÍŠ sú skutočná a PRAVÁ VIERA...mimochodom kucma...ako môžem byť ateista, keď nie som veriaci...kucma..opakujem ja neverím ja VIEM ŽE BOH A JEŽÍŠ EXISTUJÚ...stál som pred BOŽOU TVÁROU, zhováral som sa s ním, spolu sme sa smiali...tak prečo by som mal byť ateista?....lebo neverím klamstvám ktoré som tu rozšíril?...nemyl si ma s VERIACIMI...kucma ja VIEM....a mimochodom aj Noemová archa je skutočná...IP...to pekne vystihol...len ti tomu nechceš veriť...ozaj a skôr ako tu začneš písať o tom že som blázon...zamysli sa odkiaľ máš vedomosti...o tvojej NEVERE...lebo nikto z Vás nie je ateista....VERÍTE VŠETCI...slovo neverím ani neexistuje, je to len slovná obrátka...tú VIERU do Vás vložil BOH, keď Vás stvoril...to že Veríte úplne niečomu inému, alebo ničomu...je moja robota...otvor oči Kucma, ja Vás už klamať NIKDY nebudem...NIKDY..je čas aby ste poznali BOHA a JEŽÍŠA.


lucifer . faliqevu33   |   ip:78.141.69   |   2011-10-04  (13:47)
50% hlasovalo = 0  
mínus plus
  kucma....a to že sa zvieratá dostavili samé do Noemovej archy je BOŽIA vôľa...BOH im vnukol kam majú ísť...dokonca vybral páry:)


kucma . fyvafixa2   |   ip:87.244.22   |   2011-10-04  (14:07)
50% hlasovalo = 0  
mínus plus
  lucifer.
no ale aj to ze zabil vsetko zive na zemi okrem pasazierov lode zivota je BOZIA ROBOTA.
TEN HAJZEL VSEMOHUCI !
tak plakat za jeho synom by sme mali. no za vsetkymi ludmi, ktorych svorne utopil by sa podla mna patrilo viacej.
pochazdas z predkov noemovej archy :) mimochodom. takze vsetky doterajsie uvahy, ze adam a eva boli prvi ludia a potom dorobil ostatnych su pasé.


kucma . fyvafixa2   |   ip:87.244.22   |   2011-10-04  (14:11)
50% hlasovalo = 0  
mínus plus
  o tvojom krestanskom POKRYTECTVE som pisal aj pri inej diskusii, takze sa tam pozri, bo sa mi nechce to znova kopirovat, ani prepisovat.

http://dolezite.sk/Vedecky_nesuhlas_s_evoluciou_148.html

malo by to byt na konci.


kucma . fyvafixa2   |   ip:87.244.22   |   2011-10-04  (14:15)
50% hlasovalo = 0  
mínus plus
  lucius.
ta co? veris v ALAHA? ked slovo neverim ani neexistuje...


lucifer . faliqevu33   |   ip:78.141.69   |   2011-10-04  (15:12)
50% hlasovalo = 0  
mínus plus
  kucma...ak by si pochopil jeden základ že u BOHA nič neumiera...nepokladal by si my takúto otázku...zapamätaj si kucma...BOH NEZABÍJA...BOH TRESTÁ...všetci žijú ďalej...poniektorý v NEBI...poniektorý v PEKLE...a to isté platí aj pre ľudí a zvieratá do POTOPY...takže aby bolo raz a navždy JASNO...u BOHA NIKTO NEUMIERA...dokonca ani ti...BOH TRESTÁ...tak ako bude aj TEBA...a mimochodom kucma...verím že alah neexistuje...a vieš prečo?....lebo korán som napísal ja...lucifer.


kucma . fyvafixa2   |   ip:87.244.22   |   2011-10-04  (15:45)
50% hlasovalo = 0  
mínus plus
  lucius.
a akoze take potrestanie nekonecnym dobrom vyzera?
ozaj to akoze smrt jezisova bola co za divadlo? sak nam nic neukazal, ved nezomrel?



lucifer . faliqevu33   |   ip:78.141.69   |   2011-10-04  (16:01)
50% hlasovalo = 0  
mínus plus
  kucma...ako sa hovorí...nehádž PERLY niekomu kto si ich neváži...len by si špinil a hanobil jeho meno...ak vezmeš do ruky BIBLIU...pochopíš všetko...negoogli...choď do knižnice a prečítaj si nový zákon...všetko pochopíš...ak ti to tvoja slobodná vôľa samozrejme dovolí.


kucma . fyvafixa2   |   ip:87.244.22   |   2011-10-04  (16:02)
50% hlasovalo = 0  
mínus plus
  alah je boh. ci uz existuje alebo nie.
negacia bozstva-teizmu sa nazyva ateizmus.
ale toto ty uz samozrejme dokonale ovladas.
OBYCAJNY POKRYTECKY ATEISTA SI. NIC VIAC.


lucifer . faliqevu33   |   ip:78.141.69   |   2011-10-04  (16:04)
50% hlasovalo = 0  
mínus plus
  ...radšej diskutujme o tom prečo neveríš ti:)


lucifer . faliqevu33   |   ip:78.141.69   |   2011-10-04  (16:08)
50% hlasovalo = 0  
mínus plus
  kucma...ale ja som bohom nikdy nebol...bol som padlý anjel...teraz človek....alah...budha...krišna...to všetko sú mená...ktoré som vymyslel aby ľudia porušili hneď prvé BOŽIE PRIKÁZANIE...JA SOM TVOJ BOH A NEBUDEŠ MAŤ INÝCH BOHOV.


lucifer . faliqevu33   |   ip:78.141.69   |   2011-10-04  (16:10)
50% hlasovalo = 0  
mínus plus
  ...znova ti došli argumenty?....znova ma napádaš?...slovne?


kucma . fyvafixa2   |   ip:87.244.22   |   2011-10-04  (16:18)
50% hlasovalo = 0  
mínus plus
  lebo boh ma ma NEKONECNE RAD a JE NEKONECNE MILOSTIVY preto nie je nevyhnutne aby si VERIL.
NEMOZE TA POTRESTAT. no cisto logicky by nemal. potom by uz stratil spominane hodnoty.




lucifer . faliqevu33   |   ip:78.141.69   |   2011-10-04  (16:21)
50% hlasovalo = 0  
mínus plus
  ...samozrejme že ťa MILUJE...ale určite neponechá tvoje konania, bez potrestania...aj ti ak máš svoje dieťa, ho potrestáš len pre jeho DOBRO...či nie?


kucma . fyvafixa2   |   ip:87.244.22   |   2011-10-04  (16:21)
50% hlasovalo = 0  
mínus plus
  tak to co je za prikazanie, ked ini bohovia NEEXISTUJU?



kucma . fyvafixa2   |   ip:87.244.22   |   2011-10-04  (16:25)
50% hlasovalo = 0  
mínus plus
  no jasne.
tak ja nie som nekonecne milostivy a nedokazem nekonecne milovat.
tvoja personifikacia boha jednoznacne potrvdzuje, ze bohom si ludia predstavuju samych seba.
vypliva to aj z toho, ze si tvrdil, ze boh a jezis su biely.

ozaj, daj mail, bo odhaname citajucich k teme.
maj aj nejaky nazor na evoluciu, alebo si tu kludne budes tarat o tvojich predstavach BOHA.

si to totizto ty. neradis sa s ziadnym knazom, nenazeras do ziadenej mudrej knihy. je to len a len tvoja osobna DEMAGOGIA.

no a toto za bozie slovo nemoze povazovat NIK.


lucifer . faliqevu33   |   ip:78.141.69   |   2011-10-04  (16:28)
50% hlasovalo = 0  
mínus plus
  kucma...nebudeš mať iných bohov znamená, že nebudeš uctievať alaha, krišnu, a iných bohov...iba BOHA tvojho skutočného OTCA, ktorý ťa stvoril...a ktorý ťa MILUJE a chce len tvoje DOBRO...to dobro, ktoré máš mať v živote ti určuje ďalších 9 prikázaní....ak ich nedodržuješ...vlastne vytvoríš to čo dnes vidíš z okna.


lucifer . faliqevu33   |   ip:78.141.69   |   2011-10-04  (16:33)
50% hlasovalo = 0  
mínus plus
  Kucma...ti vôbec čítaš čo ti píšem?...píšem niekde o tom že každý sme boh?...a do kostola chodím pravidelne...nebudem s tebou diskutovať o evolúcii...lebo žiadna neexistuje...a takisto nepotrebujem ani čítať tvoje maili o nejakej evolúcii...pretože PRAVDA je len JEDNA...a to tá..že ťa stvoril BOH.


lucifer . faliqevu33   |   ip:78.141.69   |   2011-10-04  (16:36)
50% hlasovalo = 0  
mínus plus
  ...a mimochodom...ja tu BOŽIE A JEŽÍŠOVÉ slová nepíšem...ja tu BRÁNIM jeho VIERU...ktorú vy tak radi potláčate.


kucma . fyvafixa2   |   ip:87.244.22   |   2011-10-04  (16:41)
50% hlasovalo = 0  
mínus plus
  lucius.

PRAVDA nikdy nebude PRAVDOU, lebo si to povedal ty.
ak by to vazne povedal BOH, tak je VAGINOVINA, zeby pouzival tvoje usta a tvoj chory mozog.

TO ZE SA MI TU SNAZIS NANUTIT "PRAVDU" SVEDCI LEN O TOM ZE SA HRAS NA BOHA. KAPISTO?

akokolvek sa snazis, pravdu NEDOKAZES.

evolucia znamena, ze sa vyvijame. nie ze sme sa tu evoluciou vyskytli! toto sa nazyva ABIOGENEZIS.
tvoja DEMAGOGIA je preto NEMIESTNA!


lucifer . faliqevu33   |   ip:78.141.69   |   2011-10-04  (16:51)
50% hlasovalo = 0  
mínus plus
  kucma...a ako vieš že to čo tu tvrdíš ti je pravda?...JA BOHA a JEŽÍŠA OBHAJUJEM preto lebo ti tu tvrdíš že neexistujú...ti hovoríš neexistuje, ja tvrdím že BOH a JEŽÍŠ EXISTUJÚ...mimochodom BOH moje ústa nepoužíva...ja to robím z lásky k nemu a preto že VIEM že existuje....svoj excelentný názov aboigenezis si nechaj pre svojich kamarátov...pre mňa je to len cudzie a neexistujúce slovo...ktoré vymyslel človek, aby svojim teóriám dodal vážnosť...nič viac toto slovo neznamená.


lucifer . faliqevu33   |   ip:78.141.69   |   2011-10-04  (16:52)
50% hlasovalo = 0  
mínus plus
  ...a znova ma urážaš...brat môj...ja ťa mám rád:)


kucma . fyvafixa2   |   ip:87.244.22   |   2011-10-04  (16:58)
50% hlasovalo = 0  
mínus plus
  lucius.
nie som tvoj brat. nemam ta rad, pretoze ta ani nepoznam. aj tvoja "laska" je len falosna.
nerob tu zo seba svetuskara.
nerob z BOHA SRABA. nech sa taka superbytost obhajuje sama. sa mi nezda, ze akurat tvoja podpora mu CHYBA.


lucifer . faliqevu33   |   ip:78.141.69   |   2011-10-04  (17:12)
50% hlasovalo = 0  
mínus plus
  kucma..si..či sa ti to páči alebo nie...aj keď sa nepoznáme...a nepotrebujem aby si ma mal rád...neboj nebudem ti zvoniť na zvonček...moja láska k BOHU a JEŽÍŠOVY je úprimná...a pochop jednu vec...ak by sa BOH začal obhajovať sám VEDEL by si že EXISTUJE...ale BOH chce aby si UVERIL že EXISTUJE...ak UVERÍŠ a budeš žiť ako to BOH od teba vyžaduje...budeš aj VEDIEŤ...a moja podpora vychádza z mojej lásky k BOHU a JEŽÍŠOVY...robím to preto aby si TI a TEBE podobný nezblúdili ďalších...tak ako blúdiš ti...kucma....mám ťa rád:)


kucma . fyvafixa2   |   ip:87.244.22   |   2011-10-04  (17:20)
50% hlasovalo = 0  
mínus plus
  bleee.
tvoje vety nemaju zmysel. je to ako stale NEZMYSEL.
no a ten nezmysel dokazes vytvorit len ty.
to ze tvoja laska je uprimna stale nedokazuje ich EXISTENCIU. dokazuje to len existenciu tvojeJ lasky k imaginarnemu priatelovi.
a pochop jednu vec. ak by BOH vazne trval na tom aby sme uverili vsetci, tak by sa UKAZAL a potvrdil svoju EXISTENCIU. ak UVERIS nikdy to nebude znamenat VEDIET.

TO BY TYM PADOM PLATILO AJ TO, ZE AK UVERIS ZE BOH NEEXISTUJE TAK NEEXISTUJE.

ja to tiez robim preto, aby ty a tebe podobni nezbludili dalsich v BLUDNOM KRUHU KLAMSTIEV A FALOSNEJ NADEJE. pochop, ze nie kazdemu ide len o to.

lucius. ked ma mas rad, tak uz vypadni odtialto, prosim.


lenlen . lovegigu11   |   ip:85.239.25   |   2011-10-04  (17:24)
50% hlasovalo = 0  
mínus plus
  ty jo to je uchylna hra
boh chce aby si veril
nechce aby si vedel
ale veril

ano ano slepeho lahko oklames

sikovne si to na vas zidia vymysleli


lucifer . faliqevu33   |   ip:78.141.69   |   2011-10-04  (17:28)
50% hlasovalo = 0  
mínus plus
  Vypadnúť?...a či ti nevieš, že keby som nebol taký neodbytní VERILI by ste všetci...BOH sa nám ZJAVIL...zoslal svojho syna JEŽÍŠA...len tvoj problém je ten...že si v tej dobe nežil...BIBLIA nieje len KNIHA...je to aj SVEDECTVO...ale tebe to asi zbytočne budem hovoriť...však?...ale vypadnem:)...večer som tu jak na koni:)...zatiaľ ahoj...brat môj.


lenlen . lovegigu11   |   ip:85.239.25   |   2011-10-04  (17:31)
50% hlasovalo = 0  
mínus plus
  biblia je svedectvo ?
to tazko :)
v biblii ista skupina ludi vytrhla prvu stranu na ktorej stalo

tento pribeh je vymysleny , podobnost osob s realitou je cisto nahodna
jedinci so slabsim duchom by sa mali citania zdrzat
za skody vzniknute citanim si budete niest zodpovednost sami

autor : jahve


otvoreneoci . xudakybe14   |   ip:67.213.80   |   2011-10-04  (17:32)
50% hlasovalo = 0  
mínus plus
  Kucma, ja osobne neprispievam na tematiku krestanstva. Len k tvojmu nazoru chcem podotknut, ze boh sa nam dennodenne zjavuje, je vsadial okolo nas, len ho treba vidiet a citit jeho dotyk k tomu musis mat ciste otvorene srdce. Ked nemas toto tak aj ked by ta kopol do hlavy tak neuveris, ale zvalis to na Amerikanov.


kucma . fyvafixa2   |   ip:87.244.22   |   2011-10-04  (17:34)
50% hlasovalo = 0  
mínus plus
  tak dobre no ked tu budes...

OVCE sa predsa musia chodit past casto.

len mi na zaver povedz, nepatris ty medzi autorov tejto stranky nahodou?

tak sa mi vidi, ze ty nediskutujes, ty len neoblomne omielas tie svoje dristy. ani nereagujes na otazky.

nie zatial, keby som tuzil po katolickych srackach, tak by som chodil do kostola.




kucma . fyvafixa2   |   ip:87.244.22   |   2011-10-04  (17:38)
50% hlasovalo = 0  
mínus plus
  otvoreneoci.
porozpravaj sa o svojich problemoch s dakym inym. tak sa mi vidi ze si sa do debaty zapojil az prilis neskoro.



Groover . kyrovuse69   |   ip:217.119.1   |   2011-10-04  (17:41)
50% hlasovalo = 0  
mínus plus
  http://www.youtube.com/watch?v=jgLrYPZHNyY&;feature=related

;)



otvoreneoci . xudakybe14   |   ip:67.213.80   |   2011-10-04  (17:54)
50% hlasovalo = 0  
mínus plus
  kucma ja som reagoval len na tvoju poznamku preco sa boh nezjavi. Ja o tejto teme so slepimi sa nemienim dohadovat a zbytocne sa snazit vam otvorit oci. Kazdy clovek je strojcom vlastneho stastia ja do nikoho problemov nezasahujem a ak som sa ta dotkol tak to som nechcel. amen


kucma . fyvafixa2   |   ip:87.244.22   |   2011-10-04  (18:08)
50% hlasovalo = 0  
mínus plus
  otvoreneoci.

kazdy clovek je strojcom vlastneho stastia a to ze strojcom vlastneho stastia je boh su 2 veci.
jedine v tom pripade to moze platit, keby boh bola SUCAST VASICH HLAV.

to dava zmysel. preto BOHA kazdy vidi inac a nikdy sa teisti nezhodnu na presnej forme.

BOH je vase druhe JA. je to imaginarny priatel, ktory ta ma vzdy rad - nekonecne ta miluje, dokaze ti vysvetlit vsetky otazky - aj ked velmi hlupo.
nevysetluje nic. tolko otazok, bez jednotneho obsahu predsa nemoze mat jednotnu odpoved.

jedine v pripade, ze plati transformacia
NEVIEM-BOH-HALELUJA-VIEM

je to prostriedok, ako urobit z cloveka vsevediaceho - pretoze bez chybajucich odpovedi uz vie vsetko. sebapoznanim sa da dospiet ku vsetkym pravdam. NEZMYSEL, NIE VSETKY PRAVDY SU UKRYTE V TVOJOM VNUTRI.

urobit z cloveka vsemohuceho - za vsetko co vidis z okna je len preto lebo nedodrzujes 10-oro. SPROSTOST.

to ze sa nezjavi, by si nemal vediet, ale to by mal vediet len boh. zase plati ze si to ty.

povod vzniku sveta. PRETRANSFORMOVAT NEKONECNE DOBRO, na to co vidite z okna, nemoze byt PRACA DOKONALEJ OSOBY. VSEMOHUCEJ A VSEVEDIACEJ.

stale nechapem, ze je pre Vas teistov tak jednoduche pochopit vecnost BOHA, ne neviete pochopit vecnost SVETA.

kedy a kto mi uz konecne prezradi, aku ulohu tu plnil BOH PRED DOBOU, KEDY SA KONECNE ROZHODOL STVORIT SVET.

BUD HODNY SVOJHO MENA A OTVOR OCI.
VIERA ti da len tolko k ROZUMOVEJ HODNOTE CLOVEKA, ako ti da SLEPOTA K BYSTROZRAKOSTI. NAJLEPSIA VIERA JE TA SLEPA. BLAHOSLAVENI, KTORI NEVIDELI A UVERILI.

OTVOR OCI, PROSIM.





otvoreneoci . xudakybe14   |   ip:67.213.80   |   2011-10-04  (18:54)
50% hlasovalo = 0  
mínus plus
  kucma, ja nie som veriaci ja nechodim do kostola, lebo kostol stvoril clovek a co stvoril clovek nie je dokonale. Ja mam svoju vieru ktoru som nadobudol zivotnymi skusenostami. Ja som boha este nevidel, ale parkrat v zivote som citil jeho dotyk, par krat v zivote stal pri mne ked som to potreboval. Ja som necital bibliu ani koran, lebo to je dielo ludi ktory boli osvieteny a vedeli o com pisu, ale velakrat si to slovo bozie upravili v svoj prospech, takze nakoniecje to deformacia svetej pravdy. Decka som dal pokrstit, ale nenutil chodit do kostola ale viedol aby zili zivot cestneho a slusneho cloveka. Viedol som ich k tomu a stale im poukazoval aby sa nedali v zivote oklamat roznymi sektami po
dvodnikmi, ver pomalicky ale isto su na ceste k Bohu a jeho poznaniu. Pred par tyzdnami my volala najmladsia dcera cela rozrusena co sa jej stalo. Minuly rok jej umrela svagrina na predavkovanie drogami zanechala po sebe styri deti. Tieto deti teraz vychovav ich stara mater, moja dcera len kazdy vikend si ich beriew k sebe aby odbremenila trochu tu staru pani. Tie deti su male najmladsia dobre nerozprava a malo a zrazu hovori mojej dcere ze za nou chodi anjel, ze ona ho vidi. Moja dcera sa jej musela opytat par krat, lebo hned nerozumela co to decko hovori a na co ukazuje, a ty myslis ze male dvojrocne decko klame? Som stastny ze sa boh prihovoril mojej dcere cez usta toho maleho decka, lebo jej srdce je otvorene. Ja nie som bohaty skor chudobny materialne ale som velmi stastny ze mam take deti to je moje bohactvo ktore zanecham po sebe. Ja nikoho nemienim presviedcat na kazdom je aky usudok a ponaucenie si vezme co len z tohoto pribehu.


rafael . qelyhutu11   |   ip:188.167.7   |   2011-10-04  (18:56)
50% hlasovalo = 0  
mínus plus
  Ip, ja som to tam dal samozrejme na zasmiatie tu podobu so ZOO. Lebo s humorom si zacal ty . Ak sa niekto este k tomu zaobera objemom archy, ci by bola schopna pojat vsetok zivocisny druh, ine ako humor nemozno ocakavat. To predsa nemozes mysliet ani chvilu vazne, ze by sa niekto seriozne na toto podujal. Aj keby si vedel dopodrobnosti vsetky druhy zvierat, nedalo by sa to nikdy realizovat. Nie kazdy ma rad teplo, ci zimu, vlhko, ci sucho. Dokazom bezbrehej tuposti pisatelov biblie bolo, ze povazovali vsetky druhy zvierat tie, ktore vo svojom teritoriu poznali, preto sa ani takouto situaciou nemohli zaoberat, ze napr. ladove medvede by tazko v ich arche vydrzali co len tyzden. A na druhej strane vyratat objem archy s objemom zvierat, tak to uz dochadzaju vsetky vazne argumenty, zvierata predsa nie su harok papiera poskladanych na kopku, ale zive bytosti so schopnostou dychat, vylucovat, pohybovat sa. Takze ak sa trocha zacnes vaznejsie venovat aj tymto problemom, pochopis, ze ta archa je pitomost na entu.


kucma . fyvafixa2   |   ip:87.244.22   |   2011-10-04  (19:05)
50% hlasovalo = 0  
mínus plus
  otvorene oci.
no ked ti dristy maleho decka stacia na to aby si uveril, nech sa paci.
ja si skor myslim, ze takejto bajke mozu verit len ludia na urovni maleho decka.
tvrdi, ze videla anjela, nie boha .
ak by videla vilu, tak to znamena ze si vymysla, a uz by si to neriesil
mne je to v podstate jedno comu veris.
tato debata bola o evolucii. to len s luciusom sa vsetky debaty takto zvhnu, pretoze on nie je schopny argumentacie. je to len od mala cvicena ovca, ktora bola naockovana jedina pravda a tej sa drzi.
preto som ti aj povedal, ze si sa do debaty pravdepodobne zapojil dost neskoro.
vies on tvrdi, ze noemova archa je realna. no ja proti takym lziam musim oponovat. neviem presne preco, ale boli ma to ked to tu niekto bezostysne hlasa ako PRAVDU.



FestinaLente . xexoxyje53   |   ip:193.200.1   |   2011-10-04  (19:11)
50% hlasovalo = 0  
mínus plus
  Je až smiešne, ako sa ľudia s IQ vodovodnej batérie odvolávajú na zdravý rozum.


kucma . fyvafixa2   |   ip:87.244.22   |   2011-10-04  (19:15)
50% hlasovalo = 0  
mínus plus
  otvoreneoci.
nie si veriaci, nechodis do kostola.
patris do celosvetovej skupiny, ktoru ja nazyvam POLYATEISTI.
ateizmus - presvedcenie ze boh resp. bohovia neexistuju, negacia teizmu - akehokolvek!, nie len toho "jedineho spravneho!"
skor by som vyzyval teistov, aby uz pochopili, ze tak ak oni neveria v ostatnych "BOHOV" musia chapat, preco ja NEVERIM V TOHO ICH BOHA.




FestinaLente . xexoxyje53   |   ip:193.200.1   |   2011-10-04  (19:25)
50% hlasovalo = 0  
mínus plus
  však rafael?
ani klímu nepoznali...


Ip . bysoniwy6   |   ip:188.112.1   |   2011-10-04  (19:44)
50% hlasovalo = 0  
mínus plus
  Rafael:
Biblia hovorí niečo o tom, že klimatické podmienky pred potopou na zemi boli iné ako po potope. Pochybujem o tom, že by na arche boli napríklad ľadové medvede. Ako evolucionista predsa asi budeš súhlasiť, že rôzne druhy medveďov, môžu mať spoločného predka. Ja súhlasím s variabilitou a vplivom rôznych podmienok došlo k zmenám v rámci druhu. Psi majú tiež spoločného predka.
Skrátka stále to musím opakovať nemáme všetky informácie.
To skladanie papiera samozrejme že nemá nič spoločné zo živými zvieratami. Dal som to len ako ilustráciu aký môže byť skreslený ľudský odhad. Skúsil si odhadmúť bez toho aby si počítal?
Niekto si naozaj dal prácu aby tie zvierata do korábu umiestnil, nikto netvrdí že pracoval s presnýmy údajmi.



lucifer . faliqevu33   |   ip:78.141.69   |   2011-10-04  (19:46)
50% hlasovalo = 0  
mínus plus
  kucma...naočkovaná ovca?...uvedom si kucma...presvedčiť lucifera o evolúcii...je ako rozbíjať žulu hlavou...ale dobre...dajme tvoju tému..predlož my fakta a dôkazy...a ja ti ukážem PRAVDU.


otvoreneoci . xudakybe14   |   ip:67.213.80   |   2011-10-04  (19:49)
50% hlasovalo = 0  
mínus plus
  kucma ja na rozdieo od teba nikoho nepresviedcam o mojej pravde. Mojej dcere urcite to ze bude verit v boha neuberie na krase osobnej a takties duchovnej to jej moze len pridat. Ja respektujem tvoj nazor a nemam nic proti nemu, len ty sa hadzes jak zid na hovne. Mas pravdu trochu som od temy, ale ties som reagoval len na tvoj podnet. Nieco k teme na Americkom kontygente sa nasli odtlacky noh dnesneho cloveka pri otlackoch noh dynosaurov a dnesna veda o tom mlci i ked bol o tom natoceny dokument. A tych pripadov je spusta o ktorych veda mlci a ignoruje, lebo by vela teorii padlo na hubu.


kucma . fyvafixa2   |   ip:87.244.22   |   2011-10-04  (19:58)
50% hlasovalo = 0  
mínus plus
  lucius.
naco by som to robil.
naco by som rozbijal zulu hlavou.

mna na spoznanie pravdy nepotrebujes. mohol by som ti tu predkladat miliony dokazov a miliony pravdepodobnejsich hipotez, no boli by sme stale na zaciatku.

U TEBA ZIADNA EVOLUCIA NEEXISTUJE. NEROZVIJAS SA AKO CLOVEK. STOJIS ZASEKNUTY NA HYPOTEZACH NIEKDE OKOLO ROKU NULA.

normalny ludia sa vyvijaju, neziju v davnoveku a uz sa tam nikdy nevratia !!! vyvinuli sa z neho.
naposledy ti vravim, svet nevznikol evoluciou, evoluciou sa dostal do dnesnej podoby.




kucma . fyvafixa2   |   ip:87.244.22   |   2011-10-04  (20:02)
50% hlasovalo = 0  
mínus plus
  otvoreneoci.
kedze som pochopil ze si veriaci, tak mi je jasne ze uveris vsetkemu.
nic, ale vobec nic ti nebrani, aby si na zaklade dokazov vyodil nejake hypotezy, nejake zavery.
nasli sa otlacky pri dinosauroch, super. a co z toho vlastne podla teba vypliva. ze existuje BOH?
PLETIES TU FAZULU S KRUPAMI.




lucifer . faliqevu33   |   ip:78.141.69   |   2011-10-04  (20:07)
50% hlasovalo = 0  
mínus plus
  kucma...kucma...nesúď ma po obale...chcel som s tebou diskutovať o tvojich dôkazoch nie ti ich vytĺkať z hlavy...ja som vždy rád s ľuďmi diskutoval..o hocičom:)


kucma . fyvafixa2   |   ip:87.244.22   |   2011-10-04  (20:14)
50% hlasovalo = 0  
mínus plus
  lucius.
ty su uz davno s ludmi nediskutujes !

ty sa z kazdej diskusie snazis vyvodit len jediny zaver a to je velky rozdiel.

ja uz sa nemienim bavit s bibliou. najdi si niekoho ineho.






lucifer . faliqevu33   |   ip:78.141.69   |   2011-10-04  (20:22)
50% hlasovalo = 0  
mínus plus
  ...vieš kucma...ti si to síce neuvedomuješ ale závery v každej diskusii robí každý...ide len o to kto má PRAVDU...o tom sú diskusie ľudí či nie?...ja som chcel vedieť iba to čo teba tak presvedčilo že BOH neexistuje..nič viac..nič menej.


kucma . fyvafixa2   |   ip:87.244.22   |   2011-10-04  (20:41)
50% hlasovalo = 0  
mínus plus
  lucius.

niekoho ineho vravim. nemozem na vsetky otazky: kto, kedy, ako, preco stvoril tento svet, naco ho stvoril, ako cely funguje, preco sa zem toci, preco sa strieda den s nocou, preco vznikaju burky, preco vzikaju choroby, preco su niektori ludia posadnuti diablom, preco slnko svieti, preco je v noci tma, preco je ludsky zivot s porovnanim celeho sveta tak maly a bezvyznamny, kde je koniec sveta, aky velky je vesmir, preco su na oblohe hviezdy, co bude ked zomriem, reinkarnujem sa, fakt je dusa, ako to ze mam pocity, preco si pocity len tak nelietaju kade tade ale su sucastou hmoty, plati E=MC2, co je najmensia castica sveta, plati vsetko o com hlasa kvantova fyzika, dozviem sa to vobec niekedy, dozvie sa to niekedy clovek, dozvie sa to vobec niekedy niekto,...? PRIJAT JEDINU ODPOVED - BOH.

nic viac, nic menej.

zamerne som tu hodil aj otazky minule, take, kvoli ktorym cirkev straca svoju silu a uz neplati JEDINA PRAVDA. uz davno sa pravda neziskava SVATYMI VOJNAMI A INKVIZICIOU.

nemozem odsudzovat VEDU A VEDCOV, pretoze uz mi pomohli prist na odpovede velkeho mnozstva OTAZOK RACIONALNEJSIE, NEZ TO ROBI IRACIONALNA VIERA. NIKDY NEBOLA A NIKDY NEBUDE PROTIPOLOM RACIONALITE. PRETO AK AK NIEKTO TVRDI, ZE VIERA JE PROTIPOL VEDY A VEDCOV, JE PODLA MNA IRACIONALNA.

SOM CLOVEK a ja chcem EVOLVOVAT !!!

LEN PRETO...


Groover . kyrovuse69   |   ip:217.119.1   |   2011-10-04  (20:47)
50% hlasovalo = 0  
mínus plus
  Nektar, nektar..

http://www.youtube.com/watch?v=AvmEQNmpgtA&;feature=related


lucifer . faliqevu33   |   ip:78.141.69   |   2011-10-04  (20:54)
50% hlasovalo = 0  
mínus plus
  kucma...sväté vojny...začali moslimovia...presne taký ktorý začali veriť v iného BOHA...ničili všetko sväté...do chrámov vstupovali na koňoch a bezhlavo vraždili Kresťanov...vieš každý človek sa má Právo brániť aj Kresťan...bránili svoje života a svoje sväté chrámy...vieš v tej dobe niečo ako diplomacia neexistovala...proste vyhrávalo právo silnejšieho...moslimstvo vzniklo po JEŽÍŠOVOM ukrižovaní....ak by nevzniklo moslimstvo...neboli by ani sväté vojny.


kucma . fyvafixa2   |   ip:87.244.22   |   2011-10-04  (20:59)
50% hlasovalo = 0  
mínus plus
  lucius.
:) fakt si trapko, ked tomu co si napisal aj veris...


lucifer . faliqevu33   |   ip:78.141.69   |   2011-10-04  (21:08)
50% hlasovalo = 0  
mínus plus
  ...hm...a nielen ja...ale všetci kňazi...kucma...máš milión teórii...ale PRAVDU len JEDNU.


rafael . qelyhutu11   |   ip:188.167.7   |   2011-10-05  (08:48)
50% hlasovalo = 0  
mínus plus
  IP,a kedyze potom ta potopa bola,? Lebo podla tvojich slov, ak ti evolucia vyhovuje tak sa na nu odvolavas. Bajka o arche obsahovala len zvierata, ktore poznali, samozrejme, ze v dobe hypotetickej potopy existovali aj ladove medvede, klokany, tucniaky, len oni o nich nevedeli.


Ip . bysoniwy6   |   ip:188.112.1   |   2011-10-05  (09:11)
50% hlasovalo = 0  
mínus plus
  rafael:
neodvolávam sa na evolúciu, len hovorím o tom že prirodzený výber v rámci druhu je možný.
Ty to odkiaľ vieš aké zvieratá v dobe potopy existovali, alebo nie. Bol si tam?
Pozri ja len verím tomu že predkovia živočíchov ktoré sú teraz na zemi sa zmestili na koráb o ktorom hovorí biblia. Ty ako evolucionista musíš predsa veriť, že predkovia všetkého živého sa museli zmestiť do oveľa menšieho objemu ako je koráb. Z jednej živej bunky, alebo nie?
O čase je nám škoda sa baviť, máme o ňom rozdielnu predtavu.
Ale keďže si ma obvinil, že to čo píšem nemyslím vážne (totiž to že by sa s tým mohol niekto zaoberať či sa zvieratá môžu zmestiť do korábu) dávam Ti link na knihu s ktorej som čerpal a kde si to môžeš overiť (bol som prekvapený keď som ju v takejto forme našiel na nete:
http://gloria.tv/?media=134528&;fullscreen
nakrúť si na stranu 140



rafael . qelyhutu11   |   ip:188.167.7   |   2011-10-05  (09:38)
50% hlasovalo = 0  
mínus plus
  No za prve, nebol som, zaa druhe nic take ako celosvetova potopa dokazana nebola, za tretie, vychadzam len z knihy takej istej ako ty, kde sa uvadza, ze vek Zeme je 6500 rokov, ak teda veris pitomostiam o arche a de facto celej biblii, musis verit aj tomu udavanemu roku. takze vieme, ze to nemoze byt pravda, ze by este nejake zivocichy neexistovali, tak proste evolucia neprebiehala. No a za dalsie, ak spochybnis vek udavanej potopy, ze to bolo hrozne davno, tak zasa by si mal vediet, ze v historii Zeme uz vyhynulo 99 percent vsetkych zivocichov, takze ak by Noe ich chcel zachranit, nepomohla by mu ani cela flotila tych lodiciek.


rafael . qelyhutu11   |   ip:188.167.7   |   2011-10-05  (09:40)
50% hlasovalo = 0  
mínus plus
  A poprosim ta, cituj a uvadzaj len naozaj seriozne a vedecke publikacie, to sa mozme zrovna bavit o casopise Enigma a o vsetkych jej sokujucich objavov. Internet je zla vec v tom, ze tu existuju aj taketo shity.


rafael . qelyhutu11   |   ip:188.167.7   |   2011-10-05  (11:27)
50% hlasovalo = 0  
mínus plus
  Ip, myslel som, ze si viac doveryhodny k vedeckym publikaciam, preto tieto knihy pisane evanjelickymi kreacionistami nemozes brat ani trocha vazne. Uz samotny terminus technicus slova vedecky kreacionizmus je nezmysel. No a komentovat ich vyplody zalozene na dogmatickom ponimani biblie a povazovat ich za vedecku hypotezu je ozajstna trufalost. Neraz som tu cital ,ze viera ide ruka v ruke s vedou. Ano to je mozne, ale len zo sovinistickeho pohladu viery. Vedu totiz vymysly viery nezaujimaju, nepovazuju ju dokonca ani vhodnu na komentovanie. To, ze viera sa opiera o poznatky vedy je uz ina vec, veda ale za to nemoze. Ale ak teda viera podla vas kraca ruka v ruke s vedou, musi to platit aj o ine viery, ale to vam akosi nevonia.


Ip . bysoniwy6   |   ip:188.112.7   |   2011-10-05  (21:43)
50% hlasovalo = 0  
mínus plus
  Rafael:
Si bol rýchlo s tou knihou hotový. Žeby predsudky?
Chcem len povedať esšte toľko že obidvaja veríme rovnako neuveriteľným veciam. Ja netvrdím že z kreacionistického pohľadu je všetko jasné, ale rovnako to platí aj o evolúcii. Žijeme tu pár desiatok rokov a chceš sa baviť o tisícročiach, alebo milionoch rokov. Je to smiešne veď ľudia sa niekedy nezhodnú na tom čo bolo včera, alebo pred rokom hoci pri tom boli. My nemáme poňatie čo je to jedno tisícročie. Veda môže skúmať a vyhodnocovať informácie ktoré má, keď zistí niečo nové, musí nanovo prehodnocovať. Všetko môže byť inak.



rafael . qelyhutu11   |   ip:188.167.7   |   2011-10-06  (08:35)
50% hlasovalo = 0  
mínus plus
  Mas pravdu s tou knihou, pre mna je cas vzacnejsi ako citat kreacionistov, ktori nepoznaju paleontologiu a biologiu. S tou evoluciou mas ale pravdu, tak ako kazda hypoteza aj tato prechadza roznymi formami obmeny, ci dokonca popretia, a to je na tom to fascinujuce, lebo s pribudajucimi objavmi sa dostavame dalej. Tak ako je davno zastaraly aj Darwinov model, stale biologovia prichadzaju s niecim inym, ale linia aj tak ostava. Nebudem sa s tebou bavit o case, ci jeho relativite, lebo vasa predstava pojmu casu je zasiahnuta dogmami z biblie. Vam staci si precitat nieco vedecke a hned sa to snazite napasovat do biblie. Tak je to aj s casom. Teoria relativity vas presvedcila, ze 6 dni sa da posudzovat ako miliony rokov, co je znakom ze tito privrzenci tejto viery nepochopili dilataciu casu, ci kontrakciu dlzky. Takisto suhlasim s tvojim zaverom, ze vsetko moze byt inak, ale jedno inak byt nemoze, co sa tyka veku vesmiru, je dost realnych dovodov predpokladat, ze je min. 13 mld. rokov stary, ze sa rozpina je takisto znamy a overeny fakt. To ze sa niekomu neznalemu tejto problematiky dostala nejaka informacia svedciaca o opaku je uz dana len jeho neznalostou akymi moznymi formami sa da k rozpinaniu vesmiru dopracovat. Takze moze byt naozaj vsetko inak, tak ako je vsetko inak co je v biblii povazovane za dokonalu pravdu.


Ip . bysoniwy6   |   ip:188.112.1   |   2011-10-06  (19:13)
50% hlasovalo = 0  
mínus plus
  Rafael:
Mňa biblia presvedčila hlavne s hľadiska pravdivého vykreslenia ľudskej prirodzenosti a povahy. A niele to že pravdivo popisuje to aký sme ako ľudia, ale taktiež dáva šancu na zmenu ktorú mnohý ľudia aj prežili. Podstata a zmysel náboženstva je v premene charakteru ak sa toto nedeje v živote veriaceho, tak samotná viera že Boh existuje je na nič.



rafael . qelyhutu11   |   ip:188.167.7   |   2011-10-07  (07:49)
50% hlasovalo = 0  
mínus plus
  Kluckujes, takych knih, ktore pravdivo popisuju spravanie sa cloveka je napisanych tisice, len nepotebruju omacku pisanu okolo tejto temy v podobe vymyslenych a nicim nepodlozenych pribehov.


Ip . bysoniwy6   |   ip:188.112.9   |   2011-10-07  (19:33)
50% hlasovalo = 0  
mínus plus
  Rafael:
Nemám dojem, že by som sa chcel vyhnúť nejakej téme, len nevidím zmysel veľmi o tom diskutovať. Viacmenej sa už pozname natoľko aby sme vedeli, že sa v niektorých názoroch nezhodneme. Malo by význam diskutovať ak by si si prečítal nejakú knihu, alebo pozrel nejaké video a hovorili by sme o konkrétnych veciach ktoré tam sú.
Nepopirem, že iste je hodne kníh ktoré sa zaoberajú človekom ako takým, hlavne v psychologickej oblasti, ale aj klasická literatúra. Najcennejšie sa mi ale aj tak vidia knihy, ktoré nejako čerpajú z biblie.
Aj tak by ma zaujímalo k čomu si dospel Ty čo sa týka ľudskej prirodzenosti aká je a čo s ňou.



diskusia / forum Pridaj príspevok do fóra
Prosím diskutujúcich, aby nepoužívali vulgarizmy a dodržiavali kultúru diskusie. Ďakujem. (admin)

Meno:


Tripcode (?): (nepovinné, ale odporúčané)


jeden + dva =
(výsledok zadajte číslicou)

Podmienky používania služieb dolezite.sk beriem na vedomie a súhlasim s nimi. Kliknúť tu pre celý text.

  Príspevok:


Prečo nám cirkev zamlčala a naďalej zamlčuje poznanie o reinkarnácii?


 - Prečo nám cirkev zamlčala a naďalej zamlčuje poznanie o reinkarnácii?2013-06-01  (10:13)  |  Náboženstvo a mystika
Čo nám malo byť zamlčané a prečo? Existuje reinkarnácia, teda možnosť opakovaných vtelení? 30 až 40% obyvateľstva je presvedčených o tom, že žili na Zemi už viac krát. Toto prastaré poznanie ľudstva nájdeme vo všetkých končinách Zeme a v mnohých kultúrnych kruhoch a nielen v budhizme a hinduizme ako si mnohí myslia. Reinkarnácia bola kedysi úplne prirodzeným poznaním aj v rannom kresťanstve, až kým ho kňazská kasta pred 1500 rokmi nepotlačila a neuvalila svoju kliatbu na každého, kto by tomu veril.

Fatálne omyly duchovne hľadajúcich 1


2013-05-01  (12:02)  |  Náboženstvo a mystika
Kto sa trochu hlbšie zaujíma o duchovné súvislosti života vie, že človek sa na zem nerodí iba raz. Prichádza sem viac krát a to jednak preto, aby odložil svoje staré chyby a viny a jednak preto, aby sa práve tu na zemi mohol výraznejším spôsobom duchovne posunúť nahor. Znalosť o opätovných príchodoch človeka na zem bola do piateho vatikánskeho koncilu bežne rozšírená i medzi kresťanmi a toto poznanie je až dodnes prirodzenou súčasťou všetkých východných náboženstiev.


2013: Apokalypsa ezoteriků a agónie společnosti!


2013-04-19  (10:53)  |  Náboženstvo a mystika
,,Ezoteriky, sektáře a příznivce New Age čeká po 21. prosinci 2012 podobný osud jako komunisty po rozpadu Východního bloku mezi lety 1989 – 1991.“ - Václav Bláha


Odev ako prejav ducha


2013-04-19  (09:31)  |  Náboženstvo a mystika
Týmto textom sa obraciam na nežnejšie pohlavie s výzvou, aby sa už konečne spamätali a zamysleli sa nad svojím počínaním.


Večné peklo ? BLUD RKC ! (VIDEO)


2013-04-11  (17:45)  |  Náboženstvo a mystika
Ako je možné aby náš milostivý a láskyplný Boh dopustil večné utrpenie pre tých, ktorí neprijali obeť Ježiš Krista ? Určite Boh, ktorý je nekonečná láska a chce zachrániť každú dušu by niečo také urobil ? Poďme sa spoločne pozrieť čo hovorí o tom Božie Slovo - Biblia. Učenie, že bezbožní sú trápení ohňom a sírou vo večnom pekle a že za hriechy, ktoré spáchali počas svojho krátkeho života na zemi, budú mučení tak dlho, ako dlho bude žiť Boh, je nezlučiteľné s Božou láskou a milosrdenstvom i s naším ľudským zmyslom pre spravodlivosť.


CO JE CÍRKEV?


2013-04-04  (21:53)  |  Náboženstvo a mystika
Každý národ mněl svou víru, a své bohy, a také nějakou minulost kterou si uchovávaly moudra, a vzpomínky na své předky. Ano, hovořím o nějakých pohanech anebo barbarech, i tyto národy mněly ve skutečnostech jistou civilizaci, a jiný postup životních skutečností danou jistou životní lokalitou a tím i mentálním přístupem k životu a daných jiným podmínkám. Co přinášelo jejich náboženství? Setkání svých sousedů, výměna zkušeností jak pro dobrý chod komunity, tak také pro pobavení a také nabytí informací pro další chod komunity do budoucna, osobní setkání utužovalo jistou sounáležitost a také vědomí někam se zařadit. Toto kulturní dědictví bylo ale hrubě pošlapáno katolickou vírou a doslova zneuctěno. Když si uvědomíte, že každý národ mněl ne staletí, ale tisíciletí svou víru a děděné poznatky, které se předávaly po několik tisíc generací na novou generaci, a v průběhu okamžiku jim bylo sebráno vše nějakým misionářem hrubou silou a hrozbami. Kdo se nepodřídil, byl prostě zavražděn, v jejich jazyce prostě řečeno jen "odstraněn".


Uvidel som smrť!


2013-04-04  (18:41)  |  Náboženstvo a mystika
Nie som jasnovidcom, ale stalo sa mi, že raz som predsa len niečo uvidel. Niečo strašné! Uvidel som skazu a smrť!


RKC a pápež František


2013-03-21  (11:21)  |  Náboženstvo a mystika
Tento článok by som venoval aktuálnemu dianiu v RKC, zo zameraním na pápeža Františka. Posledných niekoľko rokov som ostro kritizoval veľmi vážnu morálnu rozvrátenosť v RKC. Mnoho ľudí mi neverilo, ale dnes mi musia dať za pravdu aj fanatický katolíci. Najprv si veľmi stručne zhrňme najbližšiu históriu RKC a potom bude téma pápeža Františka


Absurdity kresťanskej viery


2013-03-21  (11:21)  |  Náboženstvo a mystika
Hlavným účelom každého náboženského systému je, aby bol človek lepší. Aby sa snažil byť čoraz lepším, čistejším, spravodlivejším a láskavejším. Aby sa o to snažil tak intenzívne, ako len môže, pretože iba tadiaľto vedie cesta k raju, ale i cesta k šťastnému, vyrovnanému a harmonickému životu na zemi.


Kauza Ján Pavol II. a vnútorný rozklad RKC


2013-03-01  (09:51)  |  Náboženstvo a mystika
Beatifikácia je predstupeň blahorečenia. Po beatifikácii Jána Pavla II. bol zastavený tento film,ktorý kritizuje jeho beatifikáciu. Beatifikovaný môže byť len človek, ktorý žil z kresťanského hľadiska veľmi vzorne, čo sa nedá o Jánovi Pavlovi II. povedať: -kryl pedofilné škandály -bol zo slobodomurármi najlepší priateľ – dali mu najvyššie ocenenie za presadzovanie ideálov NWO -kade chodil tade ohlasoval náboženskú ideológiu Nového svetového poriadku – hlásal, že všetky náboženstvá treba spojiť v jedno Ak by nám média objektívne informovali, vznikla by najväčšia mediálna kauza v dejinách ľudstva – Ján Pavol II.


Satanistický pápež? Ján Pavol II. vzdal hold NWO


2013-02-23  (16:02)  |  Náboženstvo a mystika
Som veľký kritik Jána Pavla II., pretože tento pápež vzdal hold ideológii Nového svetového poriadku. Presadzovanie ideológie NWO sa nekončilo len týmto výrokom. Kade chodil tade rozhlasoval radikálny medzináboženský ekumenizmus – jeho cieľom bola príprava sveta na jedno svetové univerzálne náboženstvo – náboženstvo ideológie Nového svetového poriadku. Kritici hovoria, že kresťanstvo a pohanské náboženstvá v žiadnom prípade nie sú zlúčiteľné, ako si to predstavoval Ján Pavol II.


Skutočný dôvod rezignácie pápeža Benedikta XVI.


2013-02-16  (15:42)  |  Náboženstvo a mystika
Nechcem o tejto problematiky písať nejaký dlhý článok – nemá to význam – problematika je veľmi jednoduchá. Musíme chápať pre pápeža bolo určite veľmi nepríjemné bývať zo slobodomurármi pod jednou strechou vo Vatikáne. Niet pochýb, že pápež ani nebol slobodný a že v skutočnosti mu vo všetkom šéfovali slobodomurári. Táto stránka sa napr. venuje veľmi závažnej kauze väznenia pápeža Siriho slobodomurármi


Katolicismus odchází z Evropy


2013-02-15  (09:18)  |  Náboženstvo a mystika
Rezignace Benedikta 16. se stala překvapením nejen pro věřící a kurii, ale také pro odborníky. Sám papež odůvodňuje tento krok zdravotními problémy. Experti však uvažují o krizi katolické církve.


Papež abdikoval, aby se vyhnul zatčení?


2013-02-15  (09:17)  |  Náboženstvo a mystika
Nevím, jakou pravdivost lze přikládat následujícímu prohlášení ITCCS. Zní to ale nadějně. ITCCS neboli Mezinárodní tribunál pro zločiny církve a státu je zřejmě dobrovolná organizace právníků, kteří připravují právnické dokumenty k obvinění představitelů církví a států, v tomto případě za zneužívání dětí. Ale není mi jasné, jak je to s jejich účinností. (Něco podobného je asi americké právnické sdružení People´s Trust, které už několikrát právně dokonale prohlásilo veškerý světový majetek za majetek všeho lidu, ale ti, co ten majetek ovládají, to jaksi zatím neberou na vědomí.) Tak to zatím berme s rezervou, a doufejme, že třeba na tom něco bude


Za papežským pučem je peněžní skandál


2013-02-14  (09:21)  |  Náboženstvo a mystika
„Abyste pochopili papežovu rezignaci“, říká Kevin Annett, „sledujte peníze“. „Tím, co bylo pro papeže Benedikta umíráčkem, bylo jeho osobní zapletení do úplatkářství a praní peněz Vatikánskou bankou.“ – Kevin Annett


Papež Benedikt 16. se vzdává pontifikátu


2013-02-12  (10:23)  |  Náboženstvo a mystika
11. února bylo oznámeno o rozhodnutí papeže Benedikta 16. zříci se trůnu. Oficiálně bude o tom vyhlášeno 28. února. O příčinách abdikace nynějšího papeže a o budoucnosti římskokatolické církve uvažují ruští experti.


Moja obhajoba


2013-02-09  (00:44)  |  Náboženstvo a mystika
Už ako malý chlapec od útleho detstva spoznával som dva svety. Mamka mi sem tam vravela o Ježiškovi a tatko nehovoril nič o Ježiškovi iba mi vždy poradil čo a ako mám robiť aby dobre bolo. Vyrastal som ako slobodné dieťa, a mohol som uvažovať ako som len chcel. Mohol som z mamkou o Ježiškovi či o strige a mohol som aj z tatkom o niečom inom trebárs o vesmíre či o svete.


Ako sa vyhnúť utrpeniu?


2013-01-27  (19:15)  |  Náboženstvo a mystika
Život je nekonečnou reťazou príčin a dôsledkov. Všetko, čo nás postretne, má svoju príčinu. Možno ju hľadať v našej nedávnej, dávnejšej, alebo veľmi dávnej minulosti. A tak je to aj s utrpením, ktoré nie je nijakým dielom náhody, ale logickým a zákonitým dôsledkom príčiny, ktorú sme my samotní kedysi v minulosti zavdali. Nijaké náhody totiž nejestvujú! Osud nie je slepý! Utrpenie je dôsledkom nami vyvolanej príčiny a prichádza k nám prostredníctvom Zákona spätného pôsobenia, ktorého účinky sa dajú veľmi výstižne vyjadriť slovami: čo kto zaseje, to aj zožne. Naše utrpenie býva teda žatvou toho, čo sme siali v minulosti. Niet v tom ľubovôle, ani nespravodlivosti. Je to dianie vecné, jasné, logické a nanajvýš spravodlivé.


Emil Páleš: Jezuitský štát v Paraguaji


2013-01-27  (11:32)  |  Náboženstvo a mystika
Kým sa Campanellovi, ktorý v talianskom väzení písal svoju knihu, pred očami vznášala vízia dokonalého štátu, jezuiti jeho utópiu premenili na skutky. Stala sa skutočnosťou v Paraguaji v roku 1609. V neprístupnom vnútrozemí amazonského pralesa, izolovaní riečnymi vodopádmi, uskutočnili teokratický komunizmus s indiánmi. Je unikátom svetovej histórie, že taký štát skutočne existoval a fungoval 150 rokov.


Emil Páleš: Biblická a katolícka Mária


2013-01-26  (00:57)  |  Náboženstvo a mystika
Biblická Mária bola pôvodne obyčajnou ľudskou ženou, pokornou, poslušnou, matkou viacerých detí (Mat 12:46, 13:55, Luk 8:19, Mar 3:31). Vedela, že sama potrebuje Spasiteľa. Súčasná katolícka Mária je nadprirodzenou bytosťou, ktorá má vlastnosti a schopnosti bohyne. Zoznam jej vlastností sa bod za bodom zhoduje s vlastnosťami pohanských bohýň, a nezhoduje s vlastnosťami biblickej matky Ježišovej.


Emil Páleš: Jezuiti


2013-01-15  (14:35)  |  Náboženstvo a mystika
Jezuiti predstavujú extrémnu saturnskú (orifielsku) inšpiráciu. Ich špecifikom sú ,saturnské vlastnosti: disciplína vôle a poslušnosť. Okrem bežných rádových sľubov cudnosti a chudoby skladali ešte jeden - o absolútnej poslušnosti pápežovi. „Pre jezuitský rád je charakteristická prísna centralizácia, tvrdá disciplína a bezvýhradná poslušnost‘ generálovi (‘, čiernemu pápežovi "), ktorý je volený doživotne.. . Jezuitský rád je organizovaný ako vojenský útvar.


Ako odhaliť jasnovidca


2013-01-10  (15:18)  |  Náboženstvo a mystika
Stačí málo na odhalenie klamára.


reakcia Tomáš Akvinský- Päť dôkazov existencie Boha


2013-01-08  (01:46)  |  Náboženstvo a mystika
Článok, priatelia, neslúži na to aby vás obrátil na neveriacich.. Dal som ho sem hlavne pre ľudí z fóra ktorý predchádzajúci článok o Tomášovi Akvinskom považovali za dôkazový materiál..


Kresťanský národ konzumentov nečistoty


2013-01-06  (18:01)  |  Náboženstvo a mystika
Slováci sú vo všeobecnosti považovaní za kresťanský národ. Štatisticky! Pravdivosť tejto štatistiky sa potvrdzuje zvlášť v čase vianočných sviatkov, kedy bývajú naplnené takmer všetky kostoly. Keď potom človek vidí tie masy, prúdiace po skončení sviatočných vianočných omší z kostolov, môže si pomyslieť: to je ale viera!


Tajomstvo obelisku.


2012-12-23  (11:57)  |  Náboženstvo a mystika
Chodíme okolo různých staveb, které někdy ani neumíme zařadit “do jaké kategorie patří“, některé jsou z doby dávno minulé, mají svůj stavební styl, někdy se na nich objevují zajímavé plastiky s různou tématikou. Ta náboženská převládá asi proto, že byla vytvořena v době, kdy církev soustředila veškerou duchovní i světskou moc do svých rukou. Víme, co znamenají různé nápisy, obrazy a sochy např. hadů a různých příšer ve společnosti svatých atd.? Známe jejich smysl? Víme komu byly určeny a proč?


Vatikán a.s., práčka špinavých peňazí mafie a politikov


2012-08-10  (08:25)  |  Náboženstvo a mystika
Zabudnite na Dana Browna. Vykašlite sa na konšpiračné teórie z dielne tvorcov Zeitgeist. Skutočnosť je oveľa napínavejšia. Skutočnosť, odhalená v knihe Vatikán a.s. Nejde totiž o fikciu, teórie alebo špekulácie. Sú to neodškriepiteľné fakty, podložené originálmi dokumentov, prevodných príkazov a bankových operácií. Ide o priame dôkazy od niekoho, kto bol súčasťou systému. Systému, ktorý s vedomím pápežov desaťročia pral špinavé peniaze nacistov, mafie a skorumpovaných politikov. Vatikánskej banky.


TEMNOTA NA VRCHOLE MOCI


2012-07-26  (15:32)  |  Náboženstvo a mystika
Všimli ste si niekedy, koľko je v našej zemí rôznych krížov umiestnených na každom kroku? Nejde iba o tie na kostoloch – tam to nikoho neprekvapí – ale ide o všetky tie po krajine. Od tých, ktoré sú na samých vrcholoch našich hôr až po tie, ktoré sú na kopci nad každou dedinou či v poliach a podobne. Tí, ktorí vidia toky energií vám povedia, čo vidia – sú to kliatby, blokácie Svetlej energie. Kríže samé osebe ešte nemusia znamenať nič, ale sú znakmi, kde je potrebné blokovať vstup Bielej, Svetlej energie. Takto si tvari „zoskrutkovali“ svoju energetickú mriežku, aby sme boli pod ich kontrolou nie iba v mestách, ale v celej krajine.


Kauza arc. Róbert Bezák, alebo – POHODA ako pre koho


2012-07-11  (11:51)  |  Náboženstvo a mystika
Zaujimavý článok o tom, prečo je dobré, že odvolali Bezáka. Na vedomie dávam hlavne list istého teológa a kňaza, ktorý je v článku.


Čo sa s nami deje po smrti?


2012-06-04  (11:53)  |  Náboženstvo a mystika
Bez znalosti jednotlivých úrovní stvorenia nemôžeme správne pochopiť, čo sa s nami deje po pozemskej smrti.


2. Prebuďte sa!


2012-05-25  (21:38)  |  Náboženstvo a mystika
Ľudia, prebuďte sa z oloveného spánku! Poznajte to nedôstojné bremeno, ktoré nesiete, a ktoré ťaží milióny ľudí nevýslovne húževnatým tlakom. Odhoďte ho! Je hodné nosenia? Ani na jednu, jedinú sekundu!


Iontové, holografické a magnetické náramky = PODVOD!


2012-05-22  (09:41)  |  Náboženstvo a mystika
Zdá se, že v každém obchodním středisku napříč USA potkáte mladého obchodníka prodávajícího barevné náramky, kterou mají údajně „iontový náboj“ nebo „magnetický hologram“, které vám způsobí lepší rovnováhu, zdraví, tlumí bolest nebo cokoliv jiného, co tvrdí. Tito obchodníci to i demonstrují ukázkou – slabost zákazníkovy síly nebo rovnováhy, pak mu nasadí náramek a provedou stejný pokus. Hle! Náhle je rovnováha na 100 procentech a síla až na střechu.


Svedectvo bývalého jasnovidca a prútikára o nebezpečenstve okultizmu


2012-05-12  (18:02)  |  Náboženstvo a mystika
Psychotronika môže byť i nebezpečná - prednáška bývalého prútkara a jasnovidca Martina Ševčíka z 12.2.1992 v Novom Meste na Morave. Autor podáva svedectvo o vlastnej skúsenosti v tejto oblasti, detailne opisuje praktiky, ktoré používal a princíp fungovania jeho schopností a zdôrazňuje nebezpečenstvá a dôsledky návštevy u ľudí s vešteckými schopnosťami.


Ďaľšie z náboženstva a mystiky...



Vyhľadávanie


Dôležité.sk na Facebooku

handmade.sk - ručná výroba, výrobky, ručná práca, predaj, obchod
Najlepšie hodnotené za týždeň

Najčítanejšie za týždeň

Posledné príspevky vo fóre

Na čo čakať
PaniWeatBeatrice . kanevehu0:   Som pani Weat Beatrice, legitímna pôžička pôžičky, dávam pôžičku veľmi vážnym ľuďom, ktorí potrebujú pôžičky finančnej podpory. Potrebujete pôžičku, aby ste svoje účty mohli odstrániť? Ak potrebujete pomoc naliehavo......

Na čo čakať
ivanmarko . lolabivy23:   Som investor.

Nižšie splátky? Ľudia nebláznite..
SERGIOOSWALDO . reqikice79:   AHOJ, DOBRÝ DEŇ,

Nižšie splátky? Ľudia nebláznite..
Romav . donyvyxa40:   Máte finančé problémy ? y máme pre Vás riešenie.

Veľký Tresk rozbil ateizmus na cimpr-campr
LorinaBlodgett . sewycecu64:   Mozno by ste si mali pozried kto je to vlastne ateista :D

OMG ...


Ďalšie...

Najdôležitejšie články

Etikoterapia

Etikoterapia vychádza z vplyvu negatívnych pocitov na dušu. Poznáme 7 najdôležitejších pocitov, ktoré nám poškodzujú zdravie - závisť, nenávisť, krivda, zloba, ľútosť, strach alebo trápenie sa za iných. Ak niektorý z týchto pocitov ľudia „pustia do svojho vnútra“, tak za všetky následky nesú sami zodpovednosť. Už Sokrates povedal, že telo je iba obalom duše . Ak ochorie duša, ochorie aj telo.


Mlieť ako kedysi alebo prečo vymreli kamenné mlyny?

Václav Havel – z jiné strany mince

TORONTSKÉ PROTOKOLY

Emil Páleš: Jezuiti

Slováci majú viac ako 8000 ročné etnické gény

Portal o ekologickej a energeticky efektivnej architekture
Náhodný výber za posledný týždeň

Zaujímavé linky

Varíme vegánsky



V tejto časti nájdete recepty bez použitia mlieka, syrov, vajec a ostatných živočíšnych produktov.


Energetické žiariče - elektrosmog

Vegan-fighter

Ľudovít Štúr

Anketa

Čo si myslite, ze sa udeje v eurozóne?


Grécko nakoniec vyhodia alebo samo odide (28%)


Euro padne, alebo budu dva druhy (36%)


Nič, premlčí sa (36%)


Navrhnite vlastú anketu
Najdôležitejšie z domova

 - Monika, Chill out!Monika, Chill out!

Ronald Reagan raz povedal Ťažká práca ešte nikoho nezabila, ale načo riskovať.


Zastavme SMER! (bankrot a peklo)

Ja som vám to hovoril!

Jiří Krampol: Trilogie...

Čipovanie psov? Neprispôsobivých sa to netýka!

Umylo vám dieťa riad? Pýtajte faktúru!

Najdôležitejšie zo sveta

VIDEO: STRANA NEZÁVISLOSTI BRITÁNIE NIGELA FARAGE ZAMĚŘUJE POZORNOST NA BILDERBERG 2013

Otázka, o čem se bude přesně diskutovat na Bilderbergu, by měla dělat starosti jak levici, tak pravici. Člen Evropského parlamentu Gerard Batten vyhlásil ohledně Bilderbegu poplach a tvrdí, že napsal všem hlavním mediálním kanálům mainstreamu v Británii zrovna tak, jako předložil i požadavek komisaři Hertfordshirské policie podle Zákona o svobodném přístupu k informacím, aby se dověděl, kdo platí náklady na všechna ta policejní opatření.


Google-Berg: Globální elita se transformuje na ...

USA se lekly úspěchů syrské armády

To, čo sa stalo v Bostone, sa v iných častiach sveta ...

Norové mění investiční politiku

USA kontra svet v štatistických číslach

Najdôležitejšie z ekonomiky

 - Kto stojí za bločkovou lotériou? Kto na tom zarobí?Kto stojí za bločkovou lotériou? Kto na tom zarobí?

Na Slovensku sa intenzívne plánuje zavedenie tzv. bločkovej lotérie. Aký prínos bude mať pre občanov Slovenska?


Tichý pohřeb pohádky o ropném zlomu

Komu patří peníze v bance?

BANKÉŘI PŘESTÁVAJÍ RESPEKTOVAT SOUKROMÉ VLASTNICTVÍ

Útok FEDu na zlato: Spekulace nakrátko a cenová ...

Trh s papírovým zlatem kolabuje

Najdôležitejšie z technológií

 - USA SCHVÁLILY POLYKACÍ PILULKY S MIKROČIPEM RFIDUSA SCHVÁLILY POLYKACÍ PILULKY S MIKROČIPEM RFID

Velká Británie nedávno schválila léky na předpis obsahující mikročipy RFID. Nyní i americký Úřad pro kontrolu potravin a léčiv schválil podobné léky s mikročipy pro použití ve Spojených státech.


VIDEO: POSTAV SI SVŮJ VLASTNÍ NEZJISTITELNÝ KALAŠNIKOV

Pozor na brýle Google

Skypuj opatrně – Microsoft čte vše, co píšeš

Kriticky o okuliaroch google glass

Funkční zbraň vytisknutá 3D tiskárnou

Najdôležitejšie z videí

Elektronický koncentrák

Podívejte se na tento dokument a zjistíte, jak moc nám NWO šlape na paty. Za jak dlouho budou povinné čipy do těla?


Tento obludný systém se reformovat nedá!

Najdôležitejšie z kníh

Kolik Američanů čte knihy?

Jak populární je v Americe čtení knih? Z těch, kteří čtou, kolik jich knihu skutečně dokončí? Jaké žánry jsou populární? A co vydavatelé - jak jim jde obchod s knihami?


Dan Millman Čísla života

Najdôležitejšie z kultúry

Pán premiér Fico: Zrušte zmluvu s Vatikánom alebo zmeňte Ústavu SR!

Právni experti  majú naďalej  výhrady voči tejto zmluve. Táto zmluva má na Slovensku totiž charakter medzinárodnej ľudskoprávnej zmluvy, ktorá má prednosť pred zákonmi aj pred slovenskou ústavou. Je to v poriadku? Naše súdy, sú a budú viazané jej obsahom. Bývalý pán premiér Dzurinda sa opäť ozval na túto tému a môže sa stať, že táto zmluva zapríčiní veľké problémy, ktoré sa v uplynulých rokoch začali ukazovať, aj súčasnej vláde. Už pád druhej Dzurindovej vlády kvôli tejto problematike ukázal aký výbušný potenciál je v tejto téme skrytý. Najlepším riešením by bolo referendum  a následné zrušenie tejto jednostrannej zmluvy... Pán premiér Fico si dúfam ako právnik uvedomuje, že nerobiť s touto zmluvou nič, môže našu krajinu priviesť do nemalých problémov.


Sexuálna výchova detí v Chorvátsku a jej pozadie – ...

Náhodný výber z archívu

Škodí fajčenie zdraviu?

Věta „Kouření vyvolává rakovinu plic!“ byla převedena na krédo v něčem, co funguje jako mechanizmus náboženského přesvědčení, v němž slepá víra supluje jakýkoli důkaz.


Bola nežná revolúcia (november 1989) podvodom?

Je islam nebezpečný? (video, česky)

Finančná kríza z hľadiska – histórie a jej rieš...

Bill Hicks - Revelations (video)

Príprava na krízu

Archív

Čipovaný ľudský "dobytok" - TVpropaganda

...ešte vakcínu s ortuťou a je to, dobytok.


Recenze: Nigel Farage - Flying Free

Zavádzanie slovenských médii ohľadne Grécka

Poďme konfrontovať Zbigniewa:

Ako také ovce

Od deda Sorosa nie je nič zadarmo!


    Pridať novú informáciu / článok  |  Mobilná verzia  |  iPhone  |  Napíšte nám  |  Nastaviť ako homepage  |  Pridať medzi obľúbené  |  RSS  |  Webmasters
   

good positive news inspirational stories articles | dôležité informácie denné správy aktuálne spravodajstvo | important actual news leaked informations spies spy espionage | zlata maska na tvar, kolagenova maska na tvar, kolagenova maska na oci, zlata maska na oci, cierna maska na tvar proti akne | handmade ručná výroba výrobky ručná práca predaj obchod handmade Náušnice náramky dekorácie Náhrdelníky Handmade obchod ručné práce hand made


Generated in 0.3171 s